KEGG   Rattus norvegicus (rat): 366984Help
Entry
366984            CDS       T01003                                 

Gene name
Cers5, Lass5
Definition
(RefSeq) ceramide synthase 5
  KO
K23727  sphingoid base N-palmitoyltransferase [EC:2.3.1.291]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00600  Sphingolipid metabolism
rno01100  Metabolic pathways
rno04071  Sphingolipid signaling pathway
Module
rno_M00094  Ceramide biosynthesis
rno_M00099  Sphingosine biosynthesis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    366984 (Cers5)
 09130 Environmental Information Processing
  09132 Signal transduction
   04071 Sphingolipid signaling pathway
    366984 (Cers5)
Enzymes [BR:rno01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.291  sphingoid base N-palmitoyltransferase
     366984 (Cers5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TRAM_LAG1_CLN8 Homeodomain
Motif
Other DBs
NCBI-GeneID: 366984
NCBI-ProteinID: NP_001102463
RGD: 1311597
Ensembl: ENSRNOG00000052990
UniProt: D4AA91
Position
7q36
AA seq 449 aa AA seqDB search
MATAAAEALGLLWGWLWSGRFWLPQNVSWADLEGPGDGYGYPRARHVLSVFPLAAGLFSV
RMLFERFIAKPCALRIGIEDSAVYQVESNVTLEKVFTSISKYPDEKRLKGLSKQLDWDVR
KIQCWFRHRRNQDKPPTLTKFCESMWRFTFYFCIFCYGVRFLWSMPWLWDTRQCWYNYPY
QPLSRELYYYYLTQLAFYWSLVFSQFIDVKRKDFLMMFMHHLIAVTLISFSYINNMVRVG
AIILCLHDSADSLLEAAKLANYARQERLCNTLFVIFGAAFMVTRLGIFPLWILNTTLFES
WEIIGPFPSWWLFNGLLLILQMLHVIWSYLIARTAFKALVRGKVTYPGGISPGSVPSALF
SPPSSFLCLVAAGQSHPLHVSKDDRSDVESSSEEDETTHTNNLSGSSSSNGANCMNGRMG
GSHLAEEQGTCKAAGNLHFGASPRIHSCD
NT seq 1350 nt NT seq  +upstreamnt  +downstreamnt
atggcgactgcggcggcggaagccctgggcctcctgtggggctggctgtggagcgggcgc
ttctggctgcctcagaacgtgagctgggcggacctggagggcccgggcgacggctacggc
tacccgcgcgcccggcacgtgctgtcggtgttcccgctggcagcaggtctcttctccgtg
aggatgctgttcgagcgatttattgctaaaccctgtgcactccgtattggcattgaagac
agtgctgtctaccaggtggaatccaatgtcacccttgagaaggtgttcacatctatctct
aagtatcctgatgagaaaaggctgaagggcctatcaaagcaactggactgggatgttcga
aaaatccaatgctggtttcgccatcggagaaatcaggacaagcctccaacgctcactaag
ttctgtgagagcatgtggagattcactttctatttttgtatcttctgctacggagtcaga
tttctctggtcgatgccttggctctgggatacccgacagtgctggtacaactatccatat
cagccactctcaagagagctctattactactatctcacacagctggccttctactggtcc
ctcgtgttctctcagtttatagatgttaaaagaaaggacttcctgatgatgtttatgcat
catttgatcgccgtcacgctcatcagtttctcctacatcaacaacatggtgcgagtggga
gccatcatcttgtgtctgcatgactccgccgactccttgctagaagctgccaagctggcc
aattacgccagacaggagcggctctgtaacaccctctttgtgatctttggtgcagctttt
atggttactcgtctagggatcttccctttgtggattctgaacacaaccctctttgagagc
tgggagattattgggccctttccttcctggtggctcttcaatggcctcctcctgatccta
cagatgttgcatgtcatctggtcctacctaatcgcacgaactgcttttaaagccttggtc
cggggcaaggtgacctacccaggagggattagccccggctctgtaccctctgctcttttc
tcacctccttcctcttttctatgcctggtggcagctggacagtcccatcctctgcatgtg
tctaaggatgaccgcagtgatgtagaaagcagctcagaggaagatgagaccacacacacg
aacaacctctctggcagcagttccagcaacggtgccaactgcatgaacggccgcatggga
ggcagccacttggctgaggagcaggggacttgtaaagctgctggcaacctacactttggg
gcctccccacgtatacactcctgtgactag

DBGET integrated database retrieval system