KEGG   Rattus norvegicus (rat): 366995Help
Entry
366995            CDS       T01003                                 

Gene name
Tbca
Definition
(RefSeq) tubulin folding cofactor A
  KO
K17292  tubulin-specific chaperone A
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:rno04812]
    366995 (Tbca)
   04147 Exosome [BR:rno04147]
    366995 (Tbca)
Cytoskeleton proteins [BR:rno04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Others
     366995 (Tbca)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   366995 (Tbca)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TBCA AAA_11 MCM6_C
Motif
Other DBs
NCBI-GeneID: 366995
NCBI-ProteinID: NP_001013263
RGD: 1311538
Ensembl: ENSRNOG00000048342
UniProt: Q6PEC1
Position
2q12
AA seq 108 aa AA seqDB search
MADPRVRQIKIKTGVVKRLVKEKVMYEKEAKQQEEKIEKMKAEDGENYAIKKQAEILQES
RMMIPDCQRRLEAAYTDLRQILESEKDLEEAEEYKEARIVLDSVKLEA
NT seq 327 nt NT seq  +upstreamnt  +downstreamnt
atggcggatcctcgcgtgaggcagatcaagatcaagaccggagtggtgaagcgactggtc
aaagaaaaagtgatgtatgaaaaagaagcaaagcagcaagaagaaaagattgagaaaatg
aaggctgaagatggtgagaactatgccattaagaagcaggcagagatcctgcaagagtcc
cggatgatgatcccagactgccagcgccggttagaggctgcttacactgatctccggcag
atactagagagcgaaaaggacttggaagaagctgaggagtacaaagaagcccgcatagtg
ctggattctgtgaagttagaggcctga

DBGET integrated database retrieval system