KEGG   Rattus norvegicus (rat): 367065
Entry
367065            CDS       T01003                                 

Gene name
Olr1295
Definition
(RefSeq) olfactory receptor 1295
  KO
K04257  olfactory receptor
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    367065 (Olr1295)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rno04030]
    367065 (Olr1295)
G protein-coupled receptors [BR:rno04030]
 Others
  Chemoreception
   Olfactory
    367065 (Olr1295)
SSDB
Motif
Pfam: 7tm_4 7tm_1 7TM_GPCR_Srv
Other DBs
NCBI-GeneID: 367065
NCBI-ProteinID: NP_001000598
RGD: 1333803
Ensembl: ENSRNOG00000049652
UniProt: M0R4Q4
Position
15p12
AA seq 314 aa
MQDMATGNHCTVTEFFLAGLSEKQEFHLPLFLLFIVIYLITVAGNLGMITLIGLSSNLHT
PMYYFLSSLSFTDFCQSTVVTPKMLVSFVTEKNIISYPGCLAQLYFFIIFGAAECYTLAA
MAYDRYLAICNPLLYNATMSYQIYSSLISGVYIFAVFCASVHTGFLTRIQFCKLDVINHF
FCDILPLLKLACSSTYIDEMLILFFGTLNIFIPTLTIIISYIFIIASILHIRSIEGKYKA
FSTCSSHISAVAIFYGSAAFMYLQPSSVSSMDQGKVSSVFYTTVVPMLNPLIYSLRNKDV
TLALKKIFERIKIM
NT seq 945 nt   +upstreamnt  +downstreamnt
atgcaggacatggcaacaggaaaccattgtacagtgactgagtttttcttggctgggctc
tcagagaagcaagaattccacctgcccctcttcctcctcttcatagtaatctatctgata
accgtggcaggaaacctgggcatgatcacattgattgggctcagttccaatctgcacaca
cccatgtactatttcctcagcagtctgtccttcactgacttctgtcagtccacagttgtt
acccctaaaatgctggtgagctttgtgacagagaagaatatcatctcctaccctggatgc
ttggctcagctctacttcttcatcatttttggggctgcagagtgctacacactagctgca
atggcatatgacagatatcttgccatttgtaacccattgctttacaatgcaaccatgtct
taccagatttacagttccttgatttcaggggtatatatttttgctgtgttctgtgcatca
gttcacacaggcttccttactaggattcagttttgcaaattagatgtgatcaatcacttt
ttctgtgatattcttcccctcttgaagcttgcatgctctagtacctatatcgatgaaatg
ttgattctattttttggtacactgaatatttttatcccaacgctgactattattatttcc
tatatcttcatcattgccagcatcctccacattcgctccatagaaggcaagtacaaagcc
ttcagtacctgtagttcccacatctccgctgttgccatcttctatggttctgctgcattc
atgtacttacagccatcatcagtgagttcaatggaccaagggaaagtgtcatctgtgttt
tatactactgttgtccccatgctgaatcctttgatctacagcctaaggaataaggatgtc
acgcttgcattgaaaaaaatatttgaaagaataaaaatcatgtaa

DBGET integrated database retrieval system