KEGG   Rattus norvegicus (rat): 367073
Entry
367073            CDS       T01003                                 

Gene name
Trappc4, Sbdn
Definition
(RefSeq) trafficking protein particle complex 4
  KO
K20303  trafficking protein particle complex subunit 4
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    367073 (Trappc4)
Membrane trafficking [BR:rno04131]
 Endosome - Golgi transport
  Tethering complex
   TRAPP complex II
    367073 (Trappc4)
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   TRAPP complex I
    367073 (Trappc4)
SSDB
Motif
Pfam: Sybindin Sedlin_N PDZ_6 PDZ
Other DBs
NCBI-GeneID: 367073
NCBI-ProteinID: NP_001003708
RGD: 1302991
Ensembl: ENSRNOG00000011904
UniProt: Q69BT7
Position
8q22
AA seq 219 aa
MAIFSVYVVNKAGGLIYQWDSYSPRAEAEKTFSYPLDLLLKLHDERVLVAFGQRDGIRVG
HAVLAINGMDVNGKYTADGKEVLEYPGNSANYPVSIRFGRPRLTSNEKLMLASMFHSLFA
IGSQLSPEQGSSGIEMLETDTFKLHCFQTLTGIKFVVLADPRQAGIDSLLRKIYEIYSDF
ALKNPFYSLEMPIRCELFDQNLKLALEVAEKAGTFGPGS
NT seq 660 nt   +upstreamnt  +downstreamnt
atggcgatttttagcgtgtacgtggtgaacaaagccggcggcctgatttaccagtgggac
agctactcgccacgggctgaagctgagaaaactttcagttacccgctggacctactgctg
aaactgcacgacgaacgagtgctggtcgctttcggccagcgagacggcatccgggtgggc
catgcagtattagccatcaatggcatggatgtaaatggcaagtacacggcggacgggaaa
gaagtgctggagtatccgggtaactctgcaaattacccggtttctattcgatttggccgg
ccccgccttacctccaatgagaagcttatgctggcctctatgttccactcgctctttgcc
attggttcccagctatctccggaacagggcagttcaggcattgagatgctggaaacagac
acgttcaaactgcactgcttccaaacactgacagggatcaagtttgtggtcctggcagat
cctaggcaagctggaatagattctcttctccgaaaaatttatgaaatttactcagacttt
gccctcaagaatccattctactccttggaaatgcctatcagatgtgagctatttgaccaa
aacctgaagctagctctcgaggtggcggagaaggctggcacttttggacctgggtcatag

DBGET integrated database retrieval system