KEGG   Rattus norvegicus (rat): 367080Help
Entry
367080            CDS       T01003                                 

Gene name
Ankk1
Definition
(RefSeq) ankyrin repeat and kinase domain containing 1
  KO
K16289  ankyrin repeat and protein kinase domain-containing protein 1 [EC:2.7.11.1]
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    367080 (Ankk1)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     367080 (Ankk1)
Protein kinases [BR:rno01001]
 Serine/threonine kinases: TKL group
  RIPK family [OT]
   367080 (Ankk1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ank_2 Ank Ank_4 Ank_3 Ank_5 Pkinase_Tyr Pkinase Haspin_kinase
Motif
Other DBs
NCBI-GeneID: 367080
NCBI-ProteinID: XP_017451675
RGD: 1305538
Ensembl: ENSRNOG00000025037
Position
8q23
AA seq 784 aa AA seqDB search
MVPHRARRLPDPMAVRPLEQQLGSLTVFTRDDFEEEWHLVASGGFSQVFQARHKRWRTQY
AIKCSPCLQKETTSSEVSCLFEEAVKMEKIKFQYIVSIYGVCKQPLGIVMEFMANGSLEK
ILPTHSLCWQLKFRIIHETSLAMNFLHSIKPPLLHLDLKPGNILLDNNMHVKISDFGLSK
WMEQSTQKQYIERSALRGTLSYIPPEMFLENNKAPGPEYDVYSFGIVVWEILTQKKPYAG
LNMMTIIIQVAAGMRPSLHDVSAEWPEEAHQMVDLMKLCWDQDPKKRPCFLNVIIETDML
LSLFQTPVADPEYEALTRKVSYKSSLSQPHRWIPTLHNTLQVSKEVSQEIADSADSDDSL
KWILQLSDSKSLVPSDIYENKVTPLHFLVARGSLEQVRLLLSHEVDVDCQTASGYTPLLI
ATQDQQPDLCALLLAHGADTNLADEDGWAPLHFAAQSGDDHTARLLLDHGALVNAREHEG
WTPLHLAAQNNFENIARLLVSRQADLNPCEAEGKTPLHVAAYFGHIGLVKLLTGQGAELD
AQQRNLRTPLHLAVEKGKVRAIQHLLKRGALPDVLDHNGYSPLHIAAAKGKYLIFKMLLR
HGASLELCTQQGWAPLHLATYKGHLEIIHLLAKSHADLDALGSMQWTPLHLAAFCGEEGM
MLALLQCGANPNAAEQSGWTPLHLAVHKGTFLGIVHLLEHGADVHACNKVGWTPAHLAAL
KGNTEILKVLVKACARLDAKDGVGCTPLQLALRSLKQSAVALLQDKEPSLAILGDSKPVP
LMDD
NT seq 2355 nt NT seq  +upstreamnt  +downstreamnt
atggtgccacacagggccaggaggcttccggaccccatggcagtcaggcccttggagcag
cagctgggcagcctcaccgtcttcacccgtgatgattttgaggaagaatggcacctagta
gccagcggtggcttcagccaggtgttccaggcaaggcacaagcgctggaggacgcagtat
gccatcaagtgctccccatgcctccagaaggaaaccaccagctctgaagtgagttgcctc
tttgaagaagcagtcaaaatggagaagattaagtttcaatacattgtgtccatctatggg
gtctgcaagcagcccctgggcatcgtgatggagttcatggctaacggttccctggagaag
atactacctacccacagcctctgctggcagctcaagttccgcatcatccacgagacaagc
ttggccatgaacttcctccacagcattaagccacccctgctccacctggaccttaagcca
ggcaacatcctgctggacaataacatgcatgtcaagatttcagattttggcctgtccaag
tggatggagcaatcaacccagaagcagtacattgagagatcagctctgaggggtacactc
agctacatacctcctgaaatgttcctggaaaataacaaggctccggggcctgaatatgat
gtgtacagctttgggattgtcgtctgggagattctcactcagaagaaaccttatgcaggg
ctcaatatgatgaccattatcatccaggtggctgcaggcatgaggccctccttgcacgat
gtctctgctgagtggccagaggaggcccatcagatggtggacctgatgaagctctgctgg
gaccaagaccccaagaagaggccatgcttcctaaatgtgatcattgagacagacatgcta
ctgtccctgttccagacccctgtggcagatcctgagtatgaagccctgacccggaaggtg
tcttacaagtcatcgctgagccagccccacaggtggatacccaccctgcacaatactttg
caggtcagcaaggaggtcagccaggagattgcagacagtgcagactcagatgactccttg
aagtggattctacagctctctgacagcaagagcttggtcccaagtgatatctatgagaac
aaggtgactcccctacactttctagtggccaggggcagcttggaacaagtgaggctgctg
ctgtcccatgaggtcgatgtagactgccagacagcttctggctatacaccactccttatt
gccacccaggaccagcagcctgacctctgtgccctgcttctggcccatggtgctgatacc
aacctggcagatgaagatggctgggccccactgcatttcgcagcccagagtggggatgac
cacactgcccgtctgctcctggaccatggcgccctggtgaatgcacgggagcatgagggt
tggaccccactccacctggctgcacagaacaactttgagaatattgcacggcttctggtc
tcccgtcaggctgatctcaacccatgtgaggcagagggcaagactcccctccatgttgcc
gcctactttggccacattggcttggtcaagctgctgacaggacagggagctgagctggat
gctcagcagagaaacctgaggacacccctgcacctggcagtggagaagggaaaagtgaga
gccattcagcacctgctaaaacgtggggcactccctgatgtgcttgaccacaatggctac
agtcctttgcacattgctgcagccaagggcaagtaccttatctttaaaatgcttctgaga
catggggccagccttgagctatgcacacaacagggatgggcacccctgcacctagcaact
tacaagggccacctggagattatccatctgttggccaagagccatgcagacctagatgct
cttggaagtatgcaatggactcccctgcacctggctgccttctgtggggaggagggaatg
atgctggcattgctgcagtgtggggccaatcccaatgccgctgagcagtcaggttggact
cctctccacctggcagtgcataaagggaccttcctgggtatcgtccaccttctggagcac
ggtgctgatgtccacgcttgcaacaaagtgggctggacacctgcccacctggctgctctc
aagggcaacacagaaatcctcaaagttctagtcaaagcttgtgcgcgactggatgccaag
gatggagttggctgtactcccttgcagctagccctccgcagcctaaagcagagtgctgtt
gccctcttgcaggacaaggaaccttcactagccattctgggagattctaaacctgtgccc
ctgatggatgattag

DBGET integrated database retrieval system