KEGG   Rattus norvegicus (rat): 367100
Entry
367100            CDS       T01003                                 

Gene name
Smad6
Definition
(RefSeq) mothers against decapentaplegic homolog 6
  KO
K04677  mothers against decapentaplegic homolog 6
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04350  TGF-beta signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    367100 (Smad6)
SSDB
Motif
Pfam: MH2 MH1
Other DBs
NCBI-GeneID: 367100
NCBI-ProteinID: NP_001102472
RGD: 1305069
Ensembl: ENSRNOG00000009173
Position
8
AA seq 495 aa
MFRSKRSGLVRRLWRSRVVPDREEGSGGGCGGDEDGSLGSRAEPAPRAREGGGCGRSEVR
SVAPRRLRDAVGPRGALIAGRRRRTGGPPRPVSEPGAGAGGSPLDVVEPGGPGWLPESDC
ETVTCCLFSERDAAGAPRDSGDPQARQSPEPEEGGGPRSREARSRLLLLEQELKTVTYSL
LKRLKERSLDTLLEAVESRGGVPGGCVLVPRADLRLGGQPAPPQLLLGRLFRWPDLQHAV
ELKPLCGCHSFAAAADGPTVCCNPYHFSRLCGPESPPPPYSRLSPPDQHKPLDLSDSTLS
YTETEATNSLITAPGEFSDASMSPDATKPSHWCSVAYWEHRTRVGRLYAVYDQAVSIFYD
LPQGSGFCLGQLNLEQRSESVRRTRSKIGFGILLSKEPDGVWAYNRGEHPIFVNSPTLDA
PGGRALVVRKVPPGYSIKVFDFERSGLLQHADAAHGPYDPHSVRISFAKGWGPCYSRQFI
TSCPCWLEILLNNHR
NT seq 1488 nt   +upstreamnt  +downstreamnt
atgttcaggtctaaacgctcggggctggtgcggcgactttggcgaagtcgtgtggtccct
gatcgggaggaaggcagcggcggcggctgtggtggcgacgaggatgggagcctgggcagc
cgagctgagcctgccccgcgggcacgagagggcggaggttgcggccgctccgaagtccgc
tcggtagccccgcggcggctccgggacgcggtgggaccgcgaggcgccctgatcgcgggc
aggcgccggcgcacagggggccccccgaggcccgtgtcggagccgggggccggagctggg
ggctccccgctggatgtggtggagcctggaggcccgggctggctgcctgagagtgactgc
gagacggtgacttgctgtctcttctccgagcgggacgctgcaggcgcgccccgggactct
ggcgatccccaagccaggcagtccccggagccggaggagggcggcgggcctcggagtcgc
gaagcccgctcgcggctgctgcttctggagcaggagctcaagacagtcacgtactcgctg
ctcaagcggctcaaggagcgttcgctggacacactgttggaggctgtagagtcccgaggc
ggcgtgccgggcggctgcgtgctggtgccgcgcgccgacctccgtctgggcggccagccc
gcgccaccgcagctgctgctcggtcgcctgttccgctggccagacctgcagcacgcagtg
gagctgaaacccctgtgcggctgccacagctttgccgccgccgctgacgggcccacggtg
tgttgcaacccctaccacttcagccggctctgcgggccagaatcaccgccgcccccctat
tctcggctgtctcctcctgaccagcacaagccactggatctgtccgattctacattgtct
tacactgaaaccgaggccaccaactccctcatcactgctccgggtgaattctcagatgcc
agcatgtctccagatgccaccaagccaagccactggtgcagcgtggcatactgggagcac
cggacacgcgtgggccgcctctatgcggtgtatgaccaggctgtcagcatcttctacgac
ctacctcagggcagcggcttctgcctgggccagctcaacctggagcagcgcagtgagtcg
gtgcggcgcacacggagcaagatcggttttggcatcctgctcagcaaggagcccgatggc
gtgtgggcctacaaccggggcgagcaccccatcttcgtcaactccccgacgctggatgcg
cccggaggccgcgccctggtcgtgcgcaaggtgccaccgggctactccatcaaggtgttc
gactttgagcgctcagggctgctgcagcacgcagacgccgctcatggcccctatgacccg
cacagcgtgcgcatcagcttcgccaagggctggggaccctgctactcgcgacagttcatc
acctcctgcccctgttggctggagatcctcctcaacaaccacagatag

KEGG   Rattus norvegicus (rat): 81516
Entry
81516             CDS       T01003                                 

Gene name
Smad7
Definition
(RefSeq) mothers against decapentaplegic homolog 7
  KO
K19631  mothers against decapentaplegic homolog 7
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04350  TGF-beta signaling pathway
rno04390  Hippo signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    81516 (Smad7)
   04390 Hippo signaling pathway
    81516 (Smad7)
SSDB
Motif
Pfam: MH2 MH1
Other DBs
NCBI-GeneID: 81516
NCBI-ProteinID: NP_110485
RGD: 69314
Ensembl: ENSRNOG00000018359
UniProt: O88406 A0A0G2JSQ5
Position
18
AA seq 426 aa
MFRTKRSALVRRLWRSRAPGGEDEEEGVGGGGGGGDLRGEGATDGRAYGAGGGGAGRAGC
CLGKAVRGAKGHHHPHPPSSGAGAAGGAEADLKALTHSVLKKLKERQLELLLQAVESRGG
TRTACLLLPGRLDCRLGPGAPASAQPAQPPSSYSLPLLLCKVFRWPDLRHSSEVKRLCCC
ESYGKINPELVCCNPHHLSRLCELESPPPPYSRYPMDFLKPTADCPDAVPSSDETGGTNY
LAPGGLSDSQLLLEPGDRSHWCVVAYWEEKTRVGRLYCVQEPSLDIFYDLPQGNGFCLGQ
LNSDNKSQLVQKVRSKIGCGIQLTREVDGVWVYNRSSYPIFIKSATLDNPDSRTLLVHKV
FPGFSIKAFDYEKAYSLQRPNDHEFMQQPWTGFTVQISFVKGWGQCYTRQFISSCPCWLE
VIFNSR
NT seq 1281 nt   +upstreamnt  +downstreamnt
atgttcaggaccaaacgatctgcgctcgtccggcgtctctggaggagccgtgcgcccggc
ggcgaggacgaggaggagggcgtggggggtggcggcggcggaggcgacctgcggggagaa
ggggcgacggacggccgggcttatggggctggtggcggcggtgcgggcagggctggctgc
tgcctgggtaaggcagtccgaggtgccaaaggtcaccaccatccccatcccccatcctcg
ggtgccggggcggccgggggcgccgaggcggatctgaaggcgctcacgcactcggtgctc
aagaaactcaaggagcggcagctggagctgctgcttcaggccgtggagtcccgcggcggt
acgcgcaccgcgtgcctcctgctgcccggccgcctggactgcaggctgggcccgggggcg
cccgccagcgcgcagcccgcgcagccgccctcgtcctactcgctccccctcctgctgtgc
aaagtgttcaggtggccggatctcaggcattcctcggaagtcaagaggctgtgttgctgt
gaatcttacgggaagatcaaccccgagctggtgtgctgcaacccccatcaccttagtcga
ctctgtgaactagagtctccccctcctccttactccagatacccgatggattttctcaaa
ccaactgcagactgtccagacgctgtaccttcctccgatgaaaccgggggaacgaattat
ctggcccctggggggctttcagattcccaacttcttctggagcctggggatcggtcacac
tggtgcgtggtggcatactgggaggagaagactcgagtggggaggctctactgtgtccaa
gagccctccctggatatcttctatgatctacctcaggggaatggcttttgcctcggacag
ctcaattcggacaacaagagtcagctggtacagaaagtgaggagcaagatcggctgtggc
atccagctgacaagggaagtggatggcgtgtgggtttacaaccgcagcagttaccccatc
ttcatcaagtccgccacactggacaacccggactccaggacgctgttggtgcacaaagtg
ttccctggtttctccatcaaggcttttgactatgaaaaggcctacagcctgcagcggccc
aatgaccacgagttcatgcagcagccatggacgggcttcaccgtgcagattagcttcgtg
aagggctggggccagtgctacacccgccagttcatcagcagttgcccgtgctggctggag
gtcatcttcaacagccggtag

DBGET integrated database retrieval system