KEGG   Rattus norvegicus (rat): 367176
Entry
367176            CDS       T01003                                 

Gene name
RGD1565653
Definition
(RefSeq) elongin-B-like isoform X1
  KO
K03873  elongin-B
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04066  HIF-1 signaling pathway
rno04120  Ubiquitin mediated proteolysis
rno05170  Human immunodeficiency virus 1 infection
rno05200  Pathways in cancer
rno05211  Renal cell carcinoma
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    367176 (RGD1565653)
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    367176 (RGD1565653)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    367176 (RGD1565653)
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    367176 (RGD1565653)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    367176 (RGD1565653)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:rno04121]
    367176 (RGD1565653)
   03400 DNA repair and recombination proteins [BR:rno03400]
    367176 (RGD1565653)
Ubiquitin system [BR:rno04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   ECV complex
    Adoptor protein
     367176 (RGD1565653)
   ECS complex
     367176 (RGD1565653)
DNA repair and recombination proteins [BR:rno03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    Other NER factors
     367176 (RGD1565653)
SSDB
Motif
Pfam: ubiquitin DUF2604 Rad60-SLD
Other DBs
NCBI-GeneID: 367176
NCBI-ProteinID: XP_017451626
RGD: 1565653
Position
8
AA seq 141 aa
MTLKVLHLSTPWKLMLRFCSVHLQIVFLMIRRHKTTIFTDPKESNTVFELKHIVKGILKR
PPEEQRLYKDGQLLDGGKTLGECGFTSQTARPQAPATVGLAFRADDTFEALRMEPFSSPL
ELPDVMKPQDSGGSGNEQAVQ
NT seq 426 nt   +upstreamnt  +downstreamnt
atgaccctgaaggtcctgcacctcagtaccccatggaagttgatgttaagattctgctct
gtgcatttacagatcgtgtttctcatgatccggcgccacaagaccactatctttacggac
cccaaggagtcgaacaccgtgttcgaactgaagcacatcgtcaagggcatcctcaagcgg
ccgccagaggagcagcggctgtacaaggacggccagctcctcgatggtggaaaaactctg
ggcgaatgtggcttcaccagtcagacagcaaggccacaggccccagccacagtgggcctg
gcctttcgagcagatgacacctttgaagcgctgcgtatggaacccttctccagccctctg
gagcttccagatgtgatgaagccacaggattctggaggcagtggcaatgaacaagccgtg
cagtga

KEGG   Rattus norvegicus (rat): 81807
Entry
81807             CDS       T01003                                 

Gene name
Elob
Definition
(RefSeq) elongin-B
  KO
K03873  elongin-B
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04066  HIF-1 signaling pathway
rno04120  Ubiquitin mediated proteolysis
rno05170  Human immunodeficiency virus 1 infection
rno05200  Pathways in cancer
rno05211  Renal cell carcinoma
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    81807 (Elob)
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    81807 (Elob)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    81807 (Elob)
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    81807 (Elob)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    81807 (Elob)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:rno04121]
    81807 (Elob)
   03400 DNA repair and recombination proteins [BR:rno03400]
    81807 (Elob)
Ubiquitin system [BR:rno04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   ECV complex
    Adoptor protein
     81807 (Elob)
   ECS complex
     81807 (Elob)
DNA repair and recombination proteins [BR:rno03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    Other NER factors
     81807 (Elob)
SSDB
Motif
Pfam: ubiquitin Rad60-SLD
Other DBs
NCBI-GeneID: 81807
NCBI-ProteinID: NP_112391
RGD: 621200
Ensembl: ENSRNOG00000004814
UniProt: P62870
Position
10
AA seq 118 aa
MDVFLMIRRHKTTIFTDAKESSTVFELKRIVEGILKRPPEEQRLYKDDQLLDDGKTLGEC
GFTSQTARPQAPATVGLAFRADDTFEALRIEPFSSPPELPDVMKPQDSGGSANEQAVQ
NT seq 357 nt   +upstreamnt  +downstreamnt
atggacgtgtttctcatgatccggcgccacaagaccaccatctttacggacgccaaggag
tcgagcacggtgttcgaactgaagcgcatcgtcgagggcatcctcaagcggccgccagag
gagcagcggctgtacaaggacgaccagctccttgatgatggaaaaactctgggcgaatgt
ggcttcaccagtcagacagcaaggccacaggccccagccacagtgggcctggcctttcga
gcagatgacacctttgaagcgctgcgtattgaacccttctccagccctccggagcttcca
gatgtgatgaagccacaggattctggaggcagtgccaatgaacaagctgtgcagtga

DBGET integrated database retrieval system