KEGG   Rattus norvegicus (rat): 367196
Entry
367196            CDS       T01003                                 

Gene name
Acad8
Definition
(RefSeq) isobutyryl-CoA dehydrogenase, mitochondrial isoform X1
  KO
K11538  isobutyryl-CoA dehydrogenase [EC:1.3.99.-]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00280  Valine, leucine and isoleucine degradation
rno01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    367196 (Acad8)
Enzymes [BR:rno01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.99  With unknown physiological acceptors
    1.3.99.-  
     367196 (Acad8)
SSDB
Motif
Pfam: Acyl-CoA_dh_1 Acyl-CoA_dh_N Acyl-CoA_dh_M Acyl-CoA_dh_2
Other DBs
NCBI-GeneID: 367196
NCBI-ProteinID: XP_038938215
RGD: 1564209
Position
8
AA seq 411 aa
MLRTGSRRLGCLRAALQSLAQTDHRSITFCIDPSLGLNEEQKGFQKVAFDFAAREMAPNM
AEWDQKELFPVDVMRKAAQLGFGGIYVRTDVGGSGLSRLDTSVIFEALATGCTSTTAYIS
IHNMCAWMIDSFGNEEQRHKFCPPLCTMEKFASYCLTEPGSGSDAASLLTSAKRQGDHYI
LNGSKAFISGGGESDIYVVMCRTGGSGPKGISCIVVEKGTPGLSFGKKEKKVGWNSQPTR
AVIFEDCAVPVANRIGTEGQGFLIAMKGLNGGRINVASCSLGAAHASVVLTQEHLKVRKQ
FGAPLARSQYLQFQLADMATKLVASRLMIRTAAVALQEEREDAVALCSMAKLFVTEECFT
ICNQALQMHGGYGYLKDYAVQQYMRDSRVHQILEGSNEVMRMLISRSLLQD
NT seq 1236 nt   +upstreamnt  +downstreamnt
atgttgcggaccggctcccggcgccttggctgtctgcgcgccgcgctccagtccctggct
cagaccgaccacaggagcatcaccttctgcatcgatccttccttggggctaaatgaagaa
caaaaaggatttcagaaagtggcctttgactttgctgctcgggaaatggctcccaacatg
gcagagtgggatcagaaggagctgttccctgtggatgtgatgcggaaggctgcacagctg
ggctttggggggatctatgtacgaacagatgtgggtgggtctggactgtctcgccttgat
acgtctgtcatctttgaagccttggccacaggctgcaccagcaccactgcctatataagc
atccacaacatgtgtgcctggatgattgatagctttggaaatgaggaacagaggcacaaa
ttttgcccaccactctgtaccatggagaagtttgcctcctactgcctcactgaaccagga
agtgggagtgatgctgcatctctcctgacctcagctaagcgacaaggagatcattacatc
ctcaacggctccaaggccttcatcagtgggggaggtgagtcagacatctatgtggtcatg
tgcagaactggtggatcaggccccaaaggtatctcctgcatagttgttgagaaaggaacc
cctggcctcagctttggcaagaaggagaagaaggtggggtggaactcgcagccaacccga
gcagtgatctttgaagactgtgctgtccctgtggccaacaggattgggactgaggggcag
ggttttctcatcgccatgaaaggactgaatggtggaaggatcaatgttgcatcctgctct
ctgggagctgcacatgcttctgttgtccttacccaagagcacctcaaggtcaggaagcag
ttcggagcacctctagccagaagccagtacctgcaattccagttggcagacatggccacc
aagctggttgcctcccggttgatgatccgcacggcagcagtggctttgcaggaggagcgg
gaagatgcagtggccctgtgttccatggccaagctctttgttacagaggaatgctttact
atttgcaaccaggctttgcagatgcatgggggctacggctacctgaaggactatgctgtt
caacagtatatgcgggactccagggtccatcaaatcctagaaggtagcaatgaagtgatg
aggatgctgatctcccggagcctgcttcaggactag

DBGET integrated database retrieval system