KEGG   Rattus norvegicus (rat): 367298
Entry
367298            CDS       T01003                                 

Gene name
Slc23a3
Definition
(RefSeq) solute carrier family 23, member 3
  KO
K14612  solute carrier family 23 (nucleobase transporter), member 3
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rno02000]
    367298 (Slc23a3)
Transporters [BR:rno02000]
 Solute carrier family (SLC)
  SLC23: Na+-dependent ascorbic acid transporter
   367298 (Slc23a3)
SSDB
Motif
Pfam: Xan_ur_permease Bap31
Other DBs
NCBI-GeneID: 367298
NCBI-ProteinID: NP_001102476
RGD: 1307402
Ensembl: ENSRNOG00000018266
UniProt: D3ZG28
Position
9q33
AA seq 610 aa
MSRSPPHPIPLLSVGSQDTPAPRPPLLPPLQDPSSRSWASWCGPSTWGLSCLLALQHFLV
LTSLLWASHLLLLHSLPPGGLSYPPAQLLASSFFSCGMSTVLQTWMGSRLPLIQAPSLEF
LIPALVLTNQKLPLMTKTPGNASLSLRLCSLTRSCHGPELWNTSLREVSGAVVMSGLLQG
TMGLLGVPGRVFPYCGPLVLAPSLVVAGLSAHKEVAQFCSAHWGLALLLILLMVVCSQHL
GSCQVPLCSWRPASTSSTHIYIPIFRLLSVLAPVACVWLISACLGLSVIPLQLSEPSDAP
WFWLPHPGEWEWPLLTPKALAAGISMALAASTSSLGCYALCGQLLHLSPPPPHACSRGLS
LEGLGSVLAGLLGSPLGTASSFPNVGTVSLFQTGSRRVAHLVGLFCMGLGLSPRLAQLFT
NIPLPVLGGVLGVTQAVVLSAGFSSFHLADIDSGRNVFIVGFSIFMALLLPRWLREAPIL
LNTGWSPMDMFLRSLLAEPIFLAGLLGFLLENTISGTRIERGLGQALPTSFTAQETQMLQ
KSRKKAAQEYGLPLSIKNLCSCIPQPLRCLCPMPEDSGDEGGSSKTGETADLLPNSGESS
SPDGREGFRS
NT seq 1833 nt   +upstreamnt  +downstreamnt
atgagcagatcacctccccatcccattccacttctatctgtgggctcccaggatacccct
gctccccgtccaccactgctaccccctctccaggatccctcctcccgctcttgggcctct
tggtgtgggccttccacctgggggctcagctgtcttctggctctacagcatttcctggtc
ttgacatctctgctctgggcctcccacctgctgctgcttcacagtctccccccaggaggg
ctctcatacccacctgctcagctcctggcttccagtttcttctcatgtggcatgtctacg
gtcctgcagacttggatgggcagcaggctgcctctaatccaggctccgtccctagagttt
cttatccctgcactggtgctgacaaaccagaagctacctctgatgaccaagacacctgga
aatgcctccctctccctacgcctgtgtagtttgacaagaagttgccatggcccggagctc
tggaacacatctctccgagaggtgtcgggggcagtggtgatgtccgggctgctgcagggc
actatgggacttctaggggtgcctggtcgtgtgtttccctactgtgggccactggtgctg
gctcccagcctggttgtggcagggctctctgcccacaaggaagtggcccagttctgttct
gctcactggggcctggccttgctgctcatcctgctcatggtggtatgctcccagcacttg
gggtcctgccaggtacccctttgctcctggaggccagcttcaacctcttcaactcacatt
tatattcctatcttccgactcctttcggtgcttgcccctgtggcctgtgtgtggctcatc
tctgcctgtctgggtctgagtgttatccccttgcagctgtctgagccctccgatgcaccg
tggttttggctgcctcacccaggtgagtgggaatggcccttgctgacacccaaggccctg
gctgcagggatctccatggctttggcagcctccaccagctccttgggttgctatgccctg
tgtggccagctgctgcatttgtctcctccaccaccacatgcctgtagtcgagggctgagc
ctggaggggctgggcagtgtgctggcagggctgctggggagtcccctgggcactgcatcc
agcttccccaatgtaggcacagtgagtcttttccagactggttctcggagagtggcccac
ctagtgggactgttctgcatggggcttggactctccccaaggctggctcagttatttacc
aacatcccactgcctgtgcttggtggggtactgggagtgacccaggctgtagttctgtct
gctggattctccagcttccacctggctgacattgactctggacgaaacgtcttcattgtg
ggcttctccatcttcatggctttgcttttgccaaggtggctccgggaagctccaatcctc
cttaacacaggctggagccccatggatatgtttctgcgttctttgctggcagaacccatt
ttcctagctggtctattgggctttctcctagaaaacactatatctggtacacggattgag
agaggcttaggtcaggccctgccaacttctttcactgcccaagaaacgcaaatgcttcag
aagtccaggaagaaagccgctcaagagtatgggcttcctttgtctatcaaaaacctgtgt
tcctgtatcccacagcctctccgttgtctctgtccaatgcctgaagactctggggatgaa
ggaggatcctctaaaacaggagagacagccgacttgttgcctaactcaggggagtcaagc
tctccggatggcagagaagggtttaggtcctag

DBGET integrated database retrieval system