KEGG   Rattus norvegicus (rat): 367302
Entry
367302            CDS       T01003                                 

Gene name
Kcne4
Definition
(RefSeq) potassium voltage-gated channel subfamily E regulatory subunit 4
  KO
K04898  potassium voltage-gated channel Isk-related subfamily E member 4
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:rno04040]
    367302 (Kcne4)
Ion channels [BR:rno04040]
 Voltage-gated cation channels
  Potassium channel, voltage-gated (Kv)
   367302 (Kcne4)
SSDB
Motif
Pfam: ISK_Channel
Other DBs
NCBI-GeneID: 367302
NCBI-ProteinID: NP_997691
RGD: 1302957
Ensembl: ENSRNOG00000048478
UniProt: Q71FD8
Position
9q34
AA seq 170 aa
MLRMEPLNSTHPSAAASSSPLESHVSSNSGGNGNEYFYILVVMSFYGIFLIGIMLGYMKS
KRREKKSSLLLLYKDEERLWGEAMKPLPMMSGLRSGQVPMMLNMLQESVAPALSCTLCSM
EGDSVSSESSSPDVHLTIQEEGADEELEETSETPLNESSEGSTENIHQNS
NT seq 513 nt   +upstreamnt  +downstreamnt
atgctgaggatggagcctctgaatagcacacacccgagcgctgcagcttccagcagcccc
cttgagtcccatgtgtctagtaacagcggtggtaatggcaacgaatacttctatattttg
gtcgttatgtccttctatggcattttcttgattggaatcatgctgggctacatgaaatcc
aagaggcgggagaagaagtccagcctcctgctgctgtacaaagatgaggagaggctgtgg
ggggaggctatgaagccgctacctatgatgtccggcctgaggtcagggcaggtgcccatg
atgctgaacatgcttcaagagagtgtggcgcctgcgctgtcctgcaccctttgctctatg
gaaggggatagtgtgagctccgagtcctcctcgcctgacgtgcacctcaccatccaggaa
gagggggctgatgaggagcttgaggagacctctgagacgcccctcaatgaaagcagcgaa
gggtctacagaaaacatccatcagaattcctag

DBGET integrated database retrieval system