KEGG   Rattus norvegicus (rat): 367306
Entry
367306            CDS       T01003                                 

Gene name
RGD1561755
Definition
(RefSeq) signal recognition particle 14 kDa protein-like
  KO
K03104  signal recognition particle subunit SRP14
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03060  Protein export
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    367306 (RGD1561755)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:rno02044]
    367306 (RGD1561755)
Secretion system [BR:rno02044]
 Sec (secretion) system
  Eukaryotic Sec-SRP protein
   367306 (RGD1561755)
SSDB
Motif
Pfam: SRP14
Other DBs
NCBI-GeneID: 367306
NCBI-ProteinID: XP_008765554
RGD: 1561755
Position
9
AA seq 132 aa
MVLLKSEQFLTKLTRLFQKCWSSGSVFITLKKCDGCTKPIPQKSSVEGLEPAENKCLLRA
TDGKRKISTVGSSKEENKFEMAYSNLLRADMNGLKKRDKKNKSKKSKPAVTGVATTNQLH
QCSFPVCCFQYP
NT seq 399 nt   +upstreamnt  +downstreamnt
atggtgttgctcaagagcgagcagttcctgacgaagctgaccaggctcttccagaagtgc
tggtcgtcgggtagcgtgtttatcaccctgaagaagtgtgatggttgcaccaaacccatc
ccacagaagagttccgtggagggcctcgagcccgcagaaaacaagtgtctgttaagggcc
acggatgggaaaaggaagatcagcacagtggggagctccaaagaagagaataagtttgag
atggcctattcaaatctactgagagccgacatgaatgggctgaagaagagggacaagaag
aacaagagtaagaagagcaaaccagcagtgacaggcgtggccactaccaaccagctgcac
cagtgcagttttcctgtttgctgctttcagtacccctaa

DBGET integrated database retrieval system