KEGG   Rattus norvegicus (rat): 367318
Entry
367318            CDS       T01003                                 

Gene name
Ano7, Ngep, Tmem16g
Definition
(RefSeq) anoctamin 7
  KO
K19501  anoctamin-7
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:rno04040]
    367318 (Ano7)
Ion channels [BR:rno04040]
 Chloride channels
  Chloride channel, calcium-activated (CaCC)
   367318 (Ano7)
SSDB
Motif
Pfam: Anoctamin Anoct_dimer
Other DBs
NCBI-GeneID: 367318
NCBI-ProteinID: NP_001004071
RGD: 1302987
Ensembl: ENSRNOG00000023427
UniProt: Q6IFT6
Position
9q36
AA seq 860 aa
MLRKQAGEEDSVVLIDMTSPEAGNGCSYGSTAQASEAGKQQVAPSRVGSSANPPIDFVLV
WEEDLRSRENPTQDKTDTHEIWRETFLENLRVAGLKIDQRDVQDEAAAVHYILLSAPWAV
LCYYAEDLRLKLPLQELPNQASNWSATLLEWLGIPNILLENVPDTPPEYYSCQFKASKLQ
WFLGSDNQDTFFTSTKRHQILFEILAKTPYGHQKKGLFGIDQLLAEGVFSAAFPLHDGPF
SVVPESSQVLGLTQRQVLFKHWARWGKWRKYQPLDHVRRYFGEKVALYFAWLGFYTGWLL
PAAVVGTVVFLAGCFLVFSDVPTQELCHSSDTFDMCPLCSDCSFWLLSSACTLAQAGRLF
DHGGTVFFSLFMALWAVLLLEYWKRKNATLAYRWDCSDYEDIEERPRPQFAATAPMTALN
PITGEDEPYFPEKNRVRRMLAGSVVLLMMVAVVIMCLVSIILYRAVMAIIVSKSNNAFLS
AWASRIASLTGSVVNLVFILILSKVYVILAQVLTRWEMHRTQTAFEDAFTLKVFIFQFVN
FYASPVYIAFFKGRFVGYPGNYHTLFGVRNEECPAGGCLSELAQELLVIMVGKQIINNVQ
EVLVPKLKGCWQKLCSRRKKAGMGANPAPWEADYELLPCEGLFHEYLEMVLQFGFVTIFV
AACPLAPLFALLNNWVEIRLDARKFVCEYRRPVAERAQDIGIWFHILAGLTHLAVISNAF
LLAFSSDFLPRVYYSWTRAPDLRGFLNFTLARAPPTFTSAHNRTCRYRAFRDDDGHYSPT
YWTLLAIRLAFVIVFEHVVFSTGRFLDLLVPDIPESVEIKVKREYYLAKQALADNEALLG
ATGVKGEQPPSSEPSLGLPA
NT seq 2583 nt   +upstreamnt  +downstreamnt
atgctgcggaagcaagctggagaagaagacagcgtggtgctgatcgacatgacctcccct
gaagcagggaatgggtgctcctatgggagcacagcccaagcctcagaggcaggtaaacag
caggtggcccccagcagagttgggagctctgccaaccccccaattgattttgttcttgtt
tgggaagaagacctgaggagccgagagaaccccactcaggacaagacagacacacatgaa
atctggcgggagacctttctggaaaatctccgtgtggctggcctgaaaatagatcagcgc
gatgtccaggacgaggccgctgcagtacattacatcctcctcagtgcaccctgggctgta
ctctgctactacgcagaagacctgcgcctgaagctgcctctgcaggagttacccaaccaa
gcttccaactggtcggccacccttctggagtggctgggcatccccaatattctgctggag
aatgtgcctgacacgccccctgagtattactcctgccagttcaaagcgagcaagctgcaa
tggttccttgggagtgacaaccaggacaccttcttcaccagcaccaagaggcaccagatt
ctatttgagatcctggccaagactccatatggccaccagaagaaaggcttgtttgggatt
gatcagctgctggcagaaggtgtattcagtgcagccttccctctgcatgatggcccgttc
tctgtagtcccagagagttcacaggtcctgggtctcacccagcgccaagtcctattcaag
cactgggctcgctggggcaagtggaggaagtaccagccactggaccatgtgcgaaggtac
ttcggggagaaggtggctctctactttgcctggcttgggttctacactggttggctcctg
cccgcggcagtcgtgggcacagtggtcttcctggcgggctgtttcctggtgttctcagat
gtaccaacgcaggagctgtgccacagctcggacaccttcgacatgtgcccactgtgctcc
gactgctccttttggctgctctccagtgcctgcaccctggcccaggctgggcggctcttc
gaccacggtggcactgtcttcttcagtttgttcatggcactgtgggcggtgctgcttctg
gagtactggaagcggaaaaacgccacgttggcctaccgctgggactgctctgactacgag
gacattgaggagaggcctcggccccagttcgctgcaacagcacccatgacagccctgaac
cccatcacgggggaagatgagccttactttcccgagaagaatcgtgtacgccgcatgctg
gccggttctgtggtgctcttgatgatggtggctgtggtgattatgtgtcttgtatctatc
atcctgtaccgggccgtgatggctatcatcgtgtccaagtcgaacaacgccttcctctcg
gcctgggcttcacgaattgccagcctcacagggtccgtggtgaaccttgtcttcatcctc
atcctctccaaggtctatgtgatcctggcccaggtcctaacaagatgggagatgcaccgg
acgcagaccgcgtttgaggacgccttcaccctcaaggtgttcatctttcagtttgtgaac
ttctacgcctcgcctgtgtacattgccttcttcaagggcaggtttgtgggatacccaggc
aactaccacaccttgtttggagtccgaaatgaggagtgtccagctggaggctgcctcagt
gagctggcacaggagctcctggtcatcatggtcggcaagcagatcatcaataacgtgcag
gaggttcttgtcccaaagctgaaaggctgctggcagaagttgtgctcccggaggaagaaa
gctggcatgggggccaacccagcaccttgggaggctgactatgagttgctgccttgtgag
gggctatttcatgaataccttgaaatggtgctgcagtttgggttcgtcactatctttgtg
gccgcctgcccgctggcgccgctttttgccctactcaacaactgggtggagatccgcctg
gatgcgcgcaagtttgtgtgcgagtaccggcgtcccgtagcggagcgcgcccaggacatc
ggcatctggttccacatcctagcgggcctcacccatctcgcggtcatcagcaatgctttc
ctactggccttttcctccgacttcctgccgcgtgtctactacagctggacgcgcgcccct
gacctgcgtggcttcctcaatttcacgctggcgcgtgcgccgcccaccttcacctcggca
cacaaccgcacttgccggtaccgggctttccgggatgatgacggacactattccccaact
tactggactctcctggccatccgcctggcctttgtcatcgtgtttgagcatgtggtgttc
tctactggccgtttcctggatctcttggttcctgacatcccagaatctgtggaaatcaag
gtgaagcgggaatactacttggctaaacaggcactggctgataatgaggctctccttgga
gcaacaggagtgaagggtgagcagcctccaagctcagagcccagtctgggtcttccagcc
tag

DBGET integrated database retrieval system