KEGG   Rattus norvegicus (rat): 367328
Entry
367328            CDS       T01003                                 

Gene name
Washc1
Definition
(RefSeq) WASH complex subunit 1
  KO
K18461  WAS protein family homolog 1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    367328 (Washc1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    367328 (Washc1)
Membrane trafficking [BR:rno04131]
 Protein recycling
  Others
   WASH complex
    367328 (Washc1)
SSDB
Motif
Pfam: WASH_WAHD MIC19_MIC25
Other DBs
NCBI-GeneID: 367328
NCBI-ProteinID: NP_001120862
RGD: 1310196
Ensembl: ENSRNOG00000053306
UniProt: B2RYF7
Position
9
AA seq 475 aa
MTAVKTQHSLAGQVYAVPLIQPDLRREEAIQQVADALQYLQNISGDIFSRISQRVELSRR
QLQAIGERVSLAQAKIEKIKGSKKAIKVFSSAKYPAPEHLQEYNSVFTGALDPGLQRRPR
YRIQSKHRPLDERALQEKLKYFPVCVSTKSEPEDEAEEGLGGLPSNISSISSLLLFNTTE
NLYKKYVFLDPLAGAVTKTHTMLGTEEEKLFDAPLSISKREQLEQPAPENYFYVPGLGQV
PEIDVPSYLPDLPGVADDLMYSADLGPGIAPSAPGAIPELPAFHTEVAEPFQPEREDGAL
LAPPPPPPPPPPPPPPAPTAVVSAPQPPMSPDVVTVTGKVAREEDSGSGEAHSASVQGAP
KEVVDPSSGRATLLESIRQAGGIGKAKLRSVKERKLEKKKQKEQEQVRATSQGGDLMSDL
FNKLVMRRKGISGKGPGTGTSEGPGGAFSRMSDSIPPLPPPQQPAGDEDEDDWES
NT seq 1428 nt   +upstreamnt  +downstreamnt
atgacggcggtgaagacccagcactccttggcaggccaggtttatgcggtgcccctcatc
cagccagacctgcgtcgagaggaggcaatccagcaagtggcagacgccctgcagtactta
cagaacatctccggagacatcttcagcaggatctcccagcgagtagagctgagccgacgc
cagctgcaggccattggggagagggtctccttggcccaggctaagatagagaagatcaag
ggcagtaagaaggccatcaaggtcttttccagtgccaagtacccagccccggagcacctg
caggagtataactccgtctttactggagccctggaccctggtctgcagagaagaccccgg
tacaggatccagagcaagcaccgcccactggatgagcgggctctgcaggagaagctgaaa
tactttcccgtgtgtgtgagcaccaagtcggagcctgaggatgaggctgaggagggactt
gggggtcttcccagcaacattagctccatcagctccctgctgctcttcaacaccacagaa
aacctgtataagaagtatgttttcctggaccctctggctggtgcagtaacgaaaacacac
accatgctgggcacagaggaggagaagttgttcgatgctcctctgtccatcagcaagaga
gagcagctggagcagccagctccagaaaactacttctatgtgccaggcctgggccaggtt
cctgagatcgatgtgccatcctacctacccgacttgcctggcgtcgcagacgacctgatg
tacagtgcggatttgggtcccggtattgccccgtccgctcctggtgctattccagagctg
cctgccttccatacggaggtggcggaacctttccagccagaacgggaggatggagcgctg
ttggcaccaccaccgcctcctcctcctcctccaccgccacctcccccagctcccacagcg
gtggtcagtgcgccccaaccaccgatgtcccctgatgtggtaaccgtgactggcaaggtt
gccagggaagaggactctggcagcggtgaggcccactcagcctctgttcagggagcccct
aaggaggtggttgacccctccagcggccgggccactctgcttgagtccatccgccaagcc
gggggcattggcaaggccaagctgcgcagtgtcaaggaacgcaagcttgagaagaagaaa
cagaaggagcaggagcaagtgagagctaccagccaaggcggggacttgatgtcagatctc
ttcaacaaactcgtcatgaggcgcaaaggtatctctggaaaaggacctggcactggcacc
agtgaggggcctggtggagccttcagtcgaatgtcagactccattccacctctgccgccc
ccacagcagccagcaggagacgaggacgaggatgactgggagtcctaa

DBGET integrated database retrieval system