KEGG   Rattus norvegicus (rat): 367455
Entry
367455            CDS       T01003                                 

Gene name
Lrg1
Definition
(RefSeq) leucine-rich alpha-2-glycoprotein 1
Organism
rno  Rattus norvegicus (rat)
SSDB
Motif
Pfam: LRR_8 LRR_4 LRR_9 LRRCT LRR_5
Other DBs
NCBI-GeneID: 367455
NCBI-ProteinID: NP_001009717
RGD: 1359464
Ensembl: ENSRNOG00000049918
UniProt: Q5I0E1
Position
9q12
AA seq 332 aa
MASWQHQGRTLFLLALLGGVSGLRECLILQSVKGSTVSCHGPTEFPSSLPADTVHLSVEF
SSLTQLPAAALQGCPGLQELHLSSNRLQELSPGLLAPVPRLRVLDLTRNALRSLPPGLFR
SSAALNTLVLRENQLQEASARWLQGLDALGYLDLAENRLRSLPARLLANLGALHTLDLGH
NLLESLPEGFLRGPRRLQRLHLEGNRLQRLEAGLLAPQPFLGVLFLNDNQLTAVAADSFR
GLKQLDMLDLSNNSLSSTPPGLWAFLGRPTRDMQDGFDVSHNPWVCDKDLVDLCRWLAAN
RHKMFSQNDTLCAGPEAVRGQRLLDVAELGTL
NT seq 999 nt   +upstreamnt  +downstreamnt
atggcctcttggcagcatcaagggagaaccctgttcctcctggccctcttgggcggggtg
tcgggcctcagggaatgcttgatactgcagtcggttaagggaagcacggtctcctgccac
ggtcccactgagttcccgagctccctcccggccgacactgtccatctgtcggtggaattc
tccagcctgactcagctgcccgccgccgccctgcaagggtgtcccggtctgcaggaactg
cacctctccagcaaccgcctgcaggaactgtcccccgggctgctggcgcccgtgccccgg
ctgcgcgtcctggatctgactcgcaatgctctccgcagcctgccccccggtttgttccgc
agctcggccgccctgaacaccctggtcctgagggagaaccagctgcaggaggcgagcgcg
cgctggctgcagggcctggacgccctgggctacttggacctggcggagaaccggctgcgc
tcgctgcccgctaggctccttgccaacctaggcgccctgcacaccctcgaccttgggcac
aacctgcttgagtcgctgcccgagggattcctgaggggccccaggcggctacagcgcctg
cacctggaagggaaccggctgcaaaggctggaggctggcttacttgcgccccagccgttc
ctgggcgtcctgttcctgaatgacaaccagctaaccgcagtggcggccgactcctttcgg
ggcctaaagcagctggatatgttggatctgtccaataactctctgtccagcactcccccg
ggtctgtgggcgttcctggggagaccgacccgcgatatgcaggatggtttcgatgtctcc
cacaacccctgggtctgtgacaaggacctcgtggacctgtgccgctggctggccgccaac
cgacataagatgttctcgcagaacgacacactctgtgcggggcccgaggccgtgagggga
cagcgactgctggacgtggcagagctggggaccttgtga

DBGET integrated database retrieval system