KEGG   Rattus norvegicus (rat): 367912
Entry
367912            CDS       T01003                                 

Gene name
Glra4, RGD1564103
Definition
(RefSeq) glycine receptor, alpha 4
  KO
K05271  glycine receptor alpha-4
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:rno04040]
    367912 (Glra4)
Ion channels [BR:rno04040]
 Ligand-gated channels
  Glycine
   367912 (Glra4)
SSDB
Motif
Pfam: Neur_chan_LBD Neur_chan_memb
Other DBs
NCBI-GeneID: 367912
NCBI-ProteinID: NP_001178843
RGD: 1564103
Ensembl: ENSRNOG00000002391
UniProt: D4A4R5
Position
Xq32
AA seq 456 aa
MTTLVPASLFLLLWTLPGKVLLSVALAKEDVKSGPKGSQPMSPSDFLDKLMGRTSGYDAR
IRPNFKGPPVNVTCNIFINSFGSVTETTMDYRVNVFLRQQWNDPRLAYREYPDDSLDLDP
SMLDSIWKPDLFFANEKGANFHEVTTDNKLLRIFKNGNVLYSIRLTLILSCPMDLKNFPM
DIQTCTMQLESFGYTMNDLMFEWLEDAPAVQVAEGLTLPQFILRDEKDLGYCTKHYNTGK
FTCIEVKFHLERQMGYYLIQMYIPSLLIVILSWVSFWINMDAAPARVGLGITTVLTMTTQ
SSGSRASLPKVSYVKAIDIWMAVCLLFVFAALLEYAAVNFVSRQHKEFMRLRRKQRRRHM
EEDIIREGRFYFRGYGLGHCLQARDGGPMEGSSIYSPQPPTTLLKEGETMRKVYVDRAKR
IDTISRAVFPFTFLVFNIFYWVVYKVLRSEDIHQAL
NT seq 1371 nt   +upstreamnt  +downstreamnt
atgacaactcttgttccagcaagcctcttccttcttctctggaccttgccagggaaggtc
ctcctcagtgtggctttggcaaaagaggatgtcaaatctgggcccaaaggatcccagccc
atgtccccctctgatttcttggacaagcttatgggacgaacatctggatatgatgctagg
attaggcccaatttcaaaggtccacctgtgaatgtgacctgcaacatcttcatcaacagt
tttggctccgtcactgagaccaccatggactaccgggtaaatgtcttcttgcggcagcag
tggaatgacccacgtctggcctaccgagaatatccagatgactctctggatctagaccca
tccatgctcgattctatttggaagccagacctcttctttgccaatgagaaaggggccaac
ttccatgaggtgaccacagacaacaagttactgcgcatcttcaagaatgggaatgttctc
tacagcatcagattgaccctcattttgtcctgcccaatggacctcaagaacttcccaatg
gacatccagacctgcacgatgcagctggaaagttttggctacaccatgaatgacctcatg
tttgagtggctagaagatgctcctgctgtccaagtggctgaggggttgactctaccccaa
tttatcttgcgggatgagaaggatctaggttactgtaccaagcattacaacacaggaaaa
ttcacttgcattgaggtaaagtttcacctggagcggcagatgggctactatctgattcaa
atgtacatccccagtctactcattgtcatcctgtcctgggtctccttctggatcaacatg
gatgccgcccctgctcgtgtaggccttggtatcaccactgtcctcaccatgacaactcag
agctctggatccagggcctctttgcctaaggtgtcctatgtgaaggcaattgacatctgg
atggctgtatgcctgctgtttgtatttgctgctttgcttgagtatgctgcagtcaatttt
gtctctcgtcagcataaggaatttatgagacttcgtagaaagcagagacgtcgacacatg
gaagaagacatcataagagagggccgcttctattttcgtggctatggcctaggacactgc
ctacaagcaagggatggaggtccaatggaaggctccagcatttacagtccccaacctcca
accactcttctaaaggagggagaaaccatgaggaaagtctatgtggaccgagccaagaga
attgacaccatctccagagctgtcttcccttttacttttcttgtcttcaatatcttctat
tgggttgtgtataaagtgctaaggtcagaagatatccaccaggcactgtga

DBGET integrated database retrieval system