KEGG   Rattus norvegicus (rat): 368042
Entry
368042            CDS       T01003                                 

Gene name
Btaf1, RGD1564130
Definition
(RefSeq) B-TFIID TATA-box binding protein associated factor 1
  KO
K15192  TATA-binding protein-associated factor [EC:3.6.4.-]
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:rno03021]
    368042 (Btaf1)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.-  
     368042 (Btaf1)
Transcription machinery [BR:rno03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Others
     368042 (Btaf1)
SSDB
Motif
Pfam: DUF3535 SNF2_N HEAT Helicase_C Vac14_Fab1_bd Cnd1 HEAT_EZ Rac1
Other DBs
NCBI-GeneID: 368042
NCBI-ProteinID: NP_001178846
RGD: 1564130
Ensembl: ENSRNOG00000017938
UniProt: F1LW16
Position
1q53
AA seq 1855 aa
MGYQACPVFLLILDRLFILLDTGTTPVTRKAAAQQLGEVVKLHPHELNNLLSKVLIYLRS
ANWDTRIAAGQAVEAIVKNVPEWNPVPRTKQEPTECSMEDSSTTDRLNFDRFDICRLLQH
GASLLGSAGAEFEVQDEKSGEVDPKERIARQRKLLQKKLGLNMGEAIGMSTEELFNDEDL
DYTPTSAALVNKQSTLQAAELIDSEFRAGMSNRQKNKAKRMAKLFAKQRSRDAVETNEKS
NDSTDGEPEEKRRKVANVVINQTASDAKVLIDNVPESSSFIEETNEWPLESFCEELCNDL
FNPSWEVRHGAGTGLREILKAHGKSGGKMGDSTLEEMIQQHQEWLEDLVIRLLCVFALDR
FGDFVSDEVVAPVRETCAQTLGVVLKHMNETGVHKTVDVLLKLLTQEQWEVRHGGLLGIK
YALAVRQDVINTLLPKVLTRIIEGLQDLDDDVRAVAAASLVPVVESLVYLQTQKVPSIIN
TLWDSLLELDDLTASTNSIMTLLSSMLTYPQVQQCSIQQSLTVLVPRVWPFLHHTISSVR
RAALETLFTLLSTQDQNSSSWLIPILSDMLRHIFQFCVLESSQEILDLIHKVWMELLSKA
SVQYVVAAACPWMGAWLCLMMQPSHLPIDLNMLLEVKARTKEKTGGKVRQGQMQSKEVLQ
EYIAGADTIMEDPATRDFVVMRARMMAAKLLGALCCCICDPGVNMVNQEIKPAESLGQLL
LFHLNSKSALQRISAALVICEWAALQKECKAVTLAVQPRLLDILSEHLYYDEIAVPFTRM
QNECKQFISSLADAHIEVGNRVNNNVLTIDQANDLVTTLFNEVTSTFDLNPQVLQQLDSK
RHQVQMTVAETNQEWQVLQLRVHTFAACAVVSLQQLPEKLNPIIKPLMETIKKEENTLVQ
NYAAQYIAKLLQQCTTRTPCPNSKVIKNLCSSLCVDPYLTPCVTCPVPTQSGQENSKGSN
SEKDGMHHTVTKHRGIITLYRHQKAAFAITSRRGPIPKAIKAQIADLPAGSSGNILVELD
EGQKPYLVQRRGAEFALTTVVKHFGAEMALKLPHLWDAMVGPLKTMIDLNNFDGKSLLER
GDAPAQELVNSLQVFETAAASMDSELHPLLVQHLPHLYMCLQYPSTAVRHMAARCVGVMS
KIATMETMNIFLEKVLPWLGAIDDNVKQEGAIEALACVMEQLDVGIVPYIVLLVVPVLGR
MSDQTDSVRFMATQCFATLIRLMPLEAGIPDPPNMSEELIQLKAKERHFLEQLLDGKKLE
NYKIPVPINAELRKYQQDGVNWLAFLNKYKLHGILCDDMGLGKTLQSICILAGDHCQRAQ
EYARSKLAECMPLPSLVVCPPTLTGHWVDEVGKFCSREYLNPLHYTGPPTERIRLQHQVK
RHNLIVASYDVVRNDIDFFRNIKFNYCILDEGHVIKNGKTKLSKAVKQLTANYRIILSGT
PIQNNVLELWSLFDFLMPGFLGTERQFAARYGKPILASRDARSSSREQEAGVLAMDALHR
QVLPFLLRRMKEDVLQDLPPKIIQDYYCTLSPLQVQLYEDFAKSRAKCDVDETVSSAALS
EETEKPKLKATGHVFQALQYLRKLCNHPALVLTPQHPEFKNTTEKLAVQNSSLHDIQHAP
KLSALKQLLLDCGLGNGTSSESGTESVVAQHRILIFCQLKSMLDIVEHDLLKPHLPSVTY
LRLDGSIPPGQRHSIVSRFNNDPSIDVLLLTTHVGGLGLNLTGADTVVFVEHDWNPMRDL
QAMDRAHRIGQKRVVNVYRLITRGTLEEKIMGLQKFKMNIANTVISQENSSLQSMGTDQL
LDLFTLDKDGKAEKADSSTSGKASMKSVLENLSDLWDAEQYDSEYNLETFMRSLE
NT seq 5568 nt   +upstreamnt  +downstreamnt
atgggctaccaggcctgtcctgttttcctcttaatactcgatcgtctttttatcttactg
gatacgggtactaccccagttacaagaaaagccgctgcacagcaacttggagaagtggtg
aaacttcatcctcatgaattaaataatttgttatctaaggtattaatatatttaaggagt
gcaaattgggatactcggattgcagcaggacaagctgttgaagctatagtgaaaaacgtg
cctgagtggaatccagtgccaagaaccaaacaagaacccacagagtgttctatggaagat
tcatctactacagatcgattaaattttgacagatttgatatatgcagattgttacagcat
ggggcatcacttttggggtctgctggtgcagaatttgaagttcaagatgaaaaatcaggt
gaagtggatcctaaagagaggatagcacgccaacggaaattattacagaagaaacttgga
cttaatatgggagaagcaattggaatgagtactgaagaactcttcaacgatgaagacttg
gattatactccaacttcagcagcccttgtaaacaaacaatctactctccaagcagctgaa
ttgattgattcagaattccgagcaggaatgagtaatagacagaagaacaaagctaaaaga
atggccaagctatttgcaaaacagagatccagggatgcagtggaaacaaatgagaagagc
aatgacagcactgatggagagccggaagaaaagagacggaaagtagcaaatgtcgttatc
aatcagactgcgagtgatgccaaagtcttgatagataatgttccagaaagttcttccttc
attgaagagacaaatgaatggcctttggaaagcttttgtgaagaactttgcaatgacctt
tttaatccttcctgggaggttcgacatggggcgggtactggactcagagaaattcttaaa
gctcatgggaaaagtggtggtaaaatgggagacagcactttagaagagatgattcagcag
catcaagagtggttggaagacttggtcattagactcctttgtgtttttgcattggacaga
tttggagactttgtttctgatgaagttgtagctccagttcgtgaaacttgtgctcaaaca
ttaggtgtcgttttaaagcacatgaacgaaacaggagttcataagacagtggatgtgctg
ctgaaattattgacacaagaacagtgggaagttagacatggtggtcttctgggaataaaa
tatgctttggcagttcgtcaggacgtgattaatactttattgcctaaagttttaactcga
ataatcgaaggactccaggaccttgatgacgatgttagagctgttgctgcagcatcctta
gttcctgtagtagaaagccttgtctaccttcagactcaaaaggtgccctccattataaat
accttatgggattctcttctggaattagatgatctaacagcttcaaccaatagtattatg
actctcctttcatccatgttaacttaccctcaggtccagcaatgcagtattcagcagtca
ctcacagttttagtcccacgggtctggccatttttacatcacactatatcttcagttcga
agagcagcattggaaactctctttacattattatcaacacaggaccagaactcgtcgtct
tggcttatccctatcctgtctgatatgctgcggcacatctttcagttctgtgttttagaa
agcagccaggaaattctggatctcattcacaaggtctggatggaactgttgagcaaggct
tcagttcagtatgtggtagcagctgcttgcccgtggatgggtgcttggctttgcttaatg
atgcagccttctcatttacctattgatttaaatatgctgctcgaagtaaaagccagaacc
aaggaaaaaacaggtggtaaggtccggcaaggtcagatgcagagtaaagaggtgcttcag
gagtacatcgcgggggcagacaccatcatggaggacccagctaccagggactttgtagtt
atgagggccaggatgatggcagctaagttgttaggagcactctgttgctgtatttgtgat
ccaggtgtaaatatggtaaaccaagaaattaaaccagcagaatccctcggccagttgcta
ctcttccatttgaattccaaatctgctttacagagaattagtgctgcgttagtaatctgt
gaatgggctgctttgcaaaaggagtgtaaagctgttaccctagctgtgcaaccgcgttta
cttgatatcctttcagaacatttgtattatgatgaaattgctgttccgttcacacgaatg
cagaatgaatgtaaacagtttatatcgtcattagctgacgcacatattgaagttggtaat
agagtaaacaacaatgttttaacaatagatcaagctaacgacctggtaactactcttttt
aatgaagtcacgtcaacttttgatttaaatcctcaagtgttacagcagttagatagtaaa
cggcatcaggtccaaatgacagttgcagagacgaaccaggagtggcaagtgttgcagctg
agagtgcatacgtttgctgcatgtgcagttgtgagcttgcagcagcttccggagaaacta
aatcctatcataaaaccacttatggaaacaattaaaaaagaagagaatacgctagtacaa
aactatgctgctcagtacatagctaagcttcttcagcagtgtacaacaaggacaccatgt
cctaattcaaaagttattaaaaacctctgtagctctctttgtgtggacccatacctcact
ccctgtgtaacatgtccagtgccaacacaaagtggccaggaaaactctaaaggatccaac
tcagaaaaagacggaatgcaccatactgtcaccaagcacagaggcatcattacgctctac
aggcatcagaaagcagcttttgccattacaagcaggagaggccctatccccaaagcaatc
aaagctcagatagcagatctacctgcaggaagtagtgggaatatcctggttgaacttgac
gagggtcaaaagccttacctggtacaacggagaggagccgaatttgccctaacaactgta
gtgaagcattttggtgctgaaatggcactgaaattgccgcatctttgggacgcgatggtt
ggtccactgaagacgatgattgacctaaataactttgatggaaagtccctcctggaaaga
ggtgatgctcctgctcaagaactggtgaattccctgcaagtgtttgaaacagcagcagct
tcgatggactctgaacttcaccccttgctggtgcagcacctgcctcatctttacatgtgc
cttcagtaccccagcactgcagtgaggcatatggcagctcgctgcgtaggcgtcatgagt
aagatagctaccatggagaccatgaatatttttttggagaaggtacttccctggctggga
gcaattgatgacaatgtcaagcaagaaggtgcaattgaagcacttgcctgtgttatggaa
caattggatgttggcattgtcccatacattgtccttttagttgttcctgtgttgggaaga
atgagtgatcagacagacagtgtgagattcatggctactcagtgctttgcaacactgatt
agactgatgccactcgaggcaggcattccggaccctccaaacatgtcagaagaattaatc
cagttgaaggcaaaagagcgacactttttagagcagttgttagatgggaagaagctagaa
aattacaagatcccagtgccaatcaatgctgagcttaggaagtaccagcaggatggtgtg
aactggttagcctttctcaataagtataagcttcatgggattctatgtgacgacatgggc
ttagggaaaacactgcagtccatctgcatcctagccggcgaccattgtcagagggcccag
gaatatgcaagatcgaaactggcagaatgtatgccacttccttccttggtggtttgccca
ccgacattaacaggccattgggtggatgaagtaggtaaattctgctccagagaatatctc
aacccattgcattatactggccctcccactgaaaggataaggttgcaacatcaagtaaaa
aggcataatctgatagtagcctcatatgatgttgtgaggaatgacatagacttttttagg
aatattaaatttaactactgtattcttgatgaaggccatgtcataaaaaatggaaaaacc
aaattgtcaaaagcagtaaaacaactgactgctaactataggattattctttctggaaca
ccaatccagaacaatgttttggagttgtggtcattatttgatttccttatgcctggattt
ttgggtactgaacgccagtttgctgctcgatatggcaaacctatattagcgagtagggat
gcacgaagctccagtcgagagcaagaagcaggtgttcttgccatggatgcactgcaccgc
caagttctgccattccttctcagaagaatgaaagaagatgttttgcaggatcttccacct
aaaattattcaagactattactgtactcttagccctctccaggttcagctttatgaagat
tttgctaagtcgcgtgccaagtgtgatgttgatgagactgtgtcttctgctgcactctca
gaagaaactgaaaaaccaaagctgaaagctacaggtcacgtgttccaggctttgcaatat
ttacgtaaactctgcaaccatccggcattggtcttaacacctcagcatccagaattcaag
aatactactgaaaagctggcagttcagaattcttcccttcatgatatccaacacgcccct
aagctctcagccctgaaacaattgctgttggactgtggcttgggaaatggcacttcttcg
gagagcggcacagagtctgttgtggcacagcacagaatactgatcttctgtcagcttaaa
agcatgctcgatatagtagaacatgatctgctcaagcctcacctgccctctgtcacttac
ttgagactggatggcagcatacctcctggacagaggcactccattgtgtcccggtttaac
aatgacccatccattgatgttcttctactcacaactcatgttggtggcctagggcttaac
ctgactggtgctgacactgtggtgtttgtggagcatgactggaaccctatgcgagattta
caggccatggaccgggcccatcgtattgggcagaaacgtgtggttaatgtctaccggttg
ataacaagaggaacactagaagaaaagatcatgggcttgcagaaattcaagatgaacatt
gcaaataccgttattagccaagaaaattccagcttacagagtatggggactgaccagctt
ctcgacctgtttactctagacaaggatggaaaggcagaaaaggctgacagctccacctct
ggaaaagcgagcatgaaatcagttcttgaaaacctgagtgacctctgggacgccgagcag
tatgattccgagtacaacctggagaccttcatgcgctctctcgagtga

DBGET integrated database retrieval system