KEGG   Rattus norvegicus (rat): 368070
Entry
368070            CDS       T01003                                 

Gene name
Pnn
Definition
(RefSeq) pinin
  KO
K13114  pinin
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03013  RNA transport
rno03015  mRNA surveillance pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    368070 (Pnn)
   03015 mRNA surveillance pathway
    368070 (Pnn)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:rno03019]
    368070 (Pnn)
   03041 Spliceosome [BR:rno03041]
    368070 (Pnn)
Messenger RNA biogenesis [BR:rno03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    EJC complex
     368070 (Pnn)
Spliceosome [BR:rno03041]
 Complex C
  Other components
   EJC/TREX
    368070 (Pnn)
SSDB
Motif
Pfam: Pinin_SDK_N Pinin_SDK_memA
Other DBs
NCBI-GeneID: 368070
NCBI-ProteinID: NP_001102493
RGD: 1597086
Ensembl: ENSRNOG00000004061
UniProt: D3ZAY8
Position
6
AA seq 729 aa
MAVAVRALQEQLEKAKESLKNVDENIRKLTGRDPNDVRPIQARLLALSGPGGGRGRGSLL
LRRGFSDSGGGPPAKQRDLEGAVSRLGGERRTRRESRQESDPEDDDVKKPALQSSVVATS
KERTRRDLIQDQNMDEKGKQRNRRIFGLLMGTLQKFKQESTVATERQKRRQEIEQKLEVQ
AEEERKQVENERRELFEERRAKQTELRLLEQKVELAQLQEEWNEHNAKIIKYIRTKTKPH
LFYIPGRMCPATQKLIEESQRKMNALFEGRRIEFAEQINKMEARPRRQSMKEKEHQVVRN
EEQKAEQEEGKVAQREEELEETGNQHNDVEIEEAGEEEKEAGVVHSDAEKDQEEEEQKQE
TEARMEEETGVREGEKQQDSQPEEVMDVLEMVESVKNVIAEQEVMETNQVESIEPSENET
SKELEPEMEFDVEPDKECKSLSPGKENINSLEVEKESEEKEEKEDKEPEPQPEPVAQPQP
PPQPLPQSQPHSQPHSQPHSQPQPALQSQPLSQPEALPLAVLQPPPQVIQEQGNLPPERK
DFPVEAIKLPEVPVEPVLTVHSENKSKNKTRSRSRGRARNKTSKSRSRSSSSSSSSSSST
SSSSGSSSSSGSSSSRSSSSSSSSTSGSSSRDSSSSSSSSSESRSRSRGRGHNRDRKHRR
SVDRKRRDTSGLERSHKSSKGGSSRDTKGSKDKNSRSDRKRSISESSRSGKRSSRSERDR
KSDRKDKRR
NT seq 2190 nt   +upstreamnt  +downstreamnt
atggcggtcgctgtgagagctttgcaggagcagctagaaaaggccaaagagagcctcaag
aatgtggacgagaatatccgcaagctcaccgggcgggacccgaatgatgtgaggcccatc
caagccagattgctggccctttctggtcctggtggaggtagaggacgaggtagtttattg
ctaaggcgtggattctcagatagtggaggaggacccccagccaaacagagagacctggaa
ggggcagtcagtaggctgggtggagagcgtcggacaagaagagaatcacgccaggaaagt
gacccagaagacgatgatgttaaaaagccagcactgcaatcttctgttgtagctacctcc
aaagaacgcacacgtagagaccttatccaggatcaaaacatggatgaaaagggaaagcaa
aggaaccgacgaatatttggcttgttgatgggcactcttcagaaatttaaacaagaatct
actgttgctactgaacggcaaaagagacgccaagaaattgaacaaaaacttgaagttcag
gctgaagaagagagaaagcaggttgaaaatgagaggagagaactgtttgaggagagacgt
gctaaacagacagaactgcggcttctggaacagaaggttgagcttgcacagctgcaagaa
gaatggaatgagcataatgccaagataattaagtatataagaaccaagacaaagccccat
ttgttctatattcctggaagaatgtgtccagctacccaaaagctaatagaagagtcacag
agaaaaatgaatgctttatttgaaggtagacgcatcgaatttgcagaacaaataaataaa
atggaggctaggcctagaagacaatcaatgaaggaaaaagagcatcaggtggtgcgtaat
gaagaacagaaggcggaacaagaagagggtaaggtggctcagcgagaggaagagttggag
gagacaggtaatcagcacaatgacgtagaaatagaggaggcaggagaggaagagaaggaa
gcaggtgtagttcatagtgatgcagagaaggaccaggaggaggaggaacaaaagcaggag
acggaggctaggatggaggaggagactggggtaagagaaggtgagaagcagcaggatagt
cagccagaagaagttatggatgtgttagagatggttgaaagtgtcaaaaatgtgattgct
gagcaggaggtgatggagactaatcaagttgaaagtatagaaccttcagaaaatgaaact
agcaaggaattggagccagagatggaatttgatgttgagccagataaagaatgtaaatct
ctttctcctggaaaagagaatattaattctctggaagtggaaaaggagtctgaggaaaaa
gaggaaaaagaagataaagagcctgagccccaacctgagcctgtggctcagcctcagccc
ccacctcagcccctgccccagagccagccccattctcagccccattctcagccccattct
cagccccaacctgcactccagtcccagcctctcagtcagcctgaggctttgccattggct
gttctgcagcctccaccccaggttattcaggagcaagggaatctacctcctgagcggaag
gattttcctgtagaggctataaaactccctgaggtgcctgtagagccagtcttgacagtg
cattcagaaaacaaaagcaaaaataagactaggagcagaagcagagggcgagcaagaaat
aaaacgagcaagagtagaagtcgcagcagcagcagcagtagttccagtagcagctctact
agtagcagcagtgggagcagctccagcagtggcagcagtagtagtcgaagcagctccagc
agcagctccagcacaagtgggagcagcagcagagacagcagcagcagcagtagcagtagc
agtgagagtaggagtcgcagtaggggccgaggacataaccgagataggaagcacagaagg
agcgtggaccggaagcgaagggacacttcaggactagaaagaagtcacaagtcttcaaaa
ggtggtagtagtagagatacgaaaggatcaaaggataagaattcccgatctgacagaaaa
aggtctatatcagagagtagtcgatcaggcaaaagatcttcaagaagtgaaagagaccga
aaatcagacaggaaagacaaaaggcgttaa

DBGET integrated database retrieval system