KEGG   Rattus norvegicus (rat): 368158
Entry
368158            CDS       T01003                                 

Gene name
Rorc
Definition
(RefSeq) nuclear receptor ROR-gamma isoform X1
  KO
K08534  RAR-related orphan receptor gamma
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04659  Th17 cell differentiation
rno04710  Circadian rhythm
rno05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    368158 (Rorc)
  09159 Environmental adaptation
   04710 Circadian rhythm
    368158 (Rorc)
 09160 Human Diseases
  09163 Immune disease
   05321 Inflammatory bowel disease
    368158 (Rorc)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    368158 (Rorc)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:rno03310]
    368158 (Rorc)
Transcription factors [BR:rno03000]
 Eukaryotic type
  Zinc finger
   Cys4 thyroid hormone receptor-like
    368158 (Rorc)
Nuclear receptors [BR:rno03310]
 1. Thyroid hormone like
  1F. RAR-related orphan receptor
   368158 (Rorc)
SSDB
Motif
Pfam: zf-C4 Hormone_recep
Other DBs
NCBI-GeneID: 368158
NCBI-ProteinID: XP_006232988
RGD: 1595785
Ensembl: ENSRNOG00000020836
Position
2
AA seq 508 aa
MDRAPQRHHRTSRELLAAKKTHTSQIEVIPCKICGDKSSGIHYGVITCEGCKGFFRRSQQ
CNVAYSCTRQQNCPIDRTSRNRCQHCRLQKCLALGMSRDAVKFGRMSKKQRDSLHAEVQK
QLQQQQQREQVAKTPPAGSHGADTLTYTLGVPDGQLPLGASPDLPEASACPPGLLRASGS
GPPYSNTLAKTEVQGASCHLEYSPERGKAEGRDSIYSTDGQLTLGRRGLQLGEPEQGSDS
HCSPSFCSAPEAPYASLTDIEYLVQNVCKSYRETCQLRLEDLLRQRTNLFSREEVTSYQR
KSMWEMWERCAHHLTEAIQYVVEFAKRLSGFMELCQNDQIILLKAGAMEVVLVRMCRAYN
ANNHTVFFEGKYGGVELFRALGCSELISSIFDFSHFLSALCFSEDEIALYTALVLINANR
PGLQEKRRVEHLQYNLELAFHHHLCKTHRQGLLAKLPPKGKLRSLCSQHVEKLQDFQHLH
PIVVQAAFPPLYKELFSTDIESSEGLSK
NT seq 1527 nt   +upstreamnt  +downstreamnt
atggacagggccccacagagacaccaccgaacatctcgggagttgctggctgcaaagaag
acccacacctcacaaatcgaagtgatcccttgcaagatctgtggggacaagtcatctggc
atccactacggggttatcacctgtgaggggtgcaagggcttcttccgccgcagccagcag
tgcaatgtggcctactcctgcacccgtcagcagaactgccccattgaccgaaccagccgc
aaccgatgccagcactgccgcctgcagaagtgcctggctctgggcatgtccagagatgct
gtcaagttcggccgaatgtccaagaagcagagggacagtctgcatgcagaggtgcagaaa
caactgcaacagcagcagcaacgggaacaagtagccaagactcctccagctgggagccat
ggagcagacacactcacatacactttaggggtcccagatgggcagctaccactgggcgcc
tcacctgacctgcccgaggcctctgcttgtccccctggcctcctgagagcctcaggctct
ggcccaccatattccaataccttggccaaaacagaggtccaaggggcctcctgccacctt
gagtatagcccagagcgaggcaaagctgaaggcagagacagcatctatagcactgacggc
cagcttactcttggaagacgtggacttcagcttggggaaccagaacagggctcagacagc
cactgcagtcccagtttctgcagtgccccagaggcaccatatgcctctctgacagacata
gagtacctggtacagaatgtctgcaagtcctaccgagagacgtgccagctacgcctggag
gaccttctacggcagcgcaccaacctcttctcacgggaggaggtgaccagctaccagagg
aagtcaatgtgggagatgtgggagcgctgtgcccaccacctcactgaggccattcagtac
gtggtggagttcgccaagcggctctcaggcttcatggagctgtgccagaatgatcagatc
atactactgaaagcaggagcaatggaagtcgtcctcgtcagaatgtgccgggcctacaat
gccaacaaccacacagtcttttttgaaggcaaatacggtggtgtggagctgttccgagcc
ttgggctgcagcgagctcatcagctccatattcgacttttcccacttcctcagcgccctg
tgtttttctgaggatgagattgccctctacacggccttggttctcatcaatgccaaccgt
cctgggctccaagaaaagaggagagtggagcatctgcaatacaatttggagctggccttt
catcatcatctctgcaagactcatcgacaaggcctcctagccaagctgccacccaagggg
aagctccggagcctgtgcagccaacatgtggaaaagctacaggacttccagcacctccac
cccatcgtggtccaagccgccttccctccactctataaggaactcttcagcactgacatt
gagtcctctgaggggctgtcaaagtga

DBGET integrated database retrieval system