KEGG   Rattus norvegicus (rat): 368178Help
Entry
368178            CDS       T01003                                 

Gene name
Hoxc9, Hoxc8
Definition
(RefSeq) homeobox C9
  KO
K09294  homeobox protein HoxB/C/D9
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    368178 (Hoxc9)
Transcription factors [BR:rno03000]
 Eukaryotic type
  Helix-turn-helix
   Homeo domain only, AbdB
    368178 (Hoxc9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hox9_act Homeodomain HTH_23 CI-B14_5a
Motif
Other DBs
NCBI-GeneID: 368178
NCBI-ProteinID: NP_001094377
RGD: 1595784
Ensembl: ENSRNOG00000016199
UniProt: D4A0V9
Position
7q36
AA seq 260 aa AA seqDB search
MSATGPISNYYVDSLISHDNEDLLASRFPATGAHPAAARPSGLVPDCSDFPSCSFAPKPA
VFSTSWAPVPSQSSVVYHPYGPQPHLGADTRYMRTWLEPLSGAVSFPSFPAGGRHYALKP
DAYPGRRADCGPGDGRSYPDYMYGSPGELRDRAPQTLPSPEADALAGSKHKEEKADLDPS
NPVANWIHARSTRKKRCPYTKYQTLELEKEFLFNMYLTRDRRYEVARVLNLTERQVKIWF
QNRRMKMKKMNKEKTDKEQS
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgtcggcgacggggcccatcagtaactattacgtggactcgctcatctctcacgacaat
gaagacctcctagcgtccaggtttccggccaccggggctcaccctgccgccgccagaccc
agcggcttggtgccggactgtagcgattttccgtcctgtagcttcgcgcccaagccggct
gtattcagcacgtcgtgggcgcccgtgccctcgcagtcgtccgtggtctatcacccttac
ggcccccagccccacctcggcgccgacacgcgctacatgcggacttggctcgagccgctg
tccggcgccgtctccttccccagcttcccagccgggggccgtcactacgccctcaagccc
gacgcctaccccgggcgccgcgccgactgcggcccgggcgacggccgcagctacccggac
tacatgtacggctctcccggggaactgcgcgaccgcgccccgcagacgctgccctcgccc
gaggcggacgcgctggccggcagcaagcacaaagaggagaaggccgacctggaccctagc
aaccccgtggccaactggatccatgcccgttccacaaggaagaagcgctgcccctacacc
aagtaccagacgctggaactggagaaggagtttctcttcaatatgtatttaactagggac
cgtcggtacgaggtggcccgtgttctcaatctcactgagcggcaggtcaaaatctggttt
cagaaccggaggatgaaaatgaaaaagatgaataaagaaaaaaccgacaaagaacaatcc
taa

DBGET integrated database retrieval system