KEGG   Rattus norvegicus (rat): 368190
Entry
368190            CDS       T01003                                 

Gene name
Dnajc30, Wbscr18
Definition
(RefSeq) DnaJ heat shock protein family (Hsp40) member C30
  KO
K19374  DnaJ homolog subfamily C member 30
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:rno03110]
    368190 (Dnajc30)
Chaperones and folding catalysts [BR:rno03110]
 Heat shock proteins
  HSP40 / DNAJ
   368190 (Dnajc30)
SSDB
Motif
Pfam: DnaJ Phage_NinH
Other DBs
NCBI-GeneID: 368190
NCBI-ProteinID: NP_001102494
RGD: 1595783
Ensembl: ENSRNOG00000031721
UniProt: B2RYV0
Position
12q12
AA seq 219 aa
MAAARCLAWPLSSLRRLWQVQGLPQSSATGLCSRVRTYSRNALYDLLGVPSTATQAQIKA
AYYRQSFLYHPDRNPGSTEAAERFTRISEAYLVLGSTILRRKYDRGLLSDQDLRGPGVKP
SKTPVADPTPPRPPPYTPRAHGGSRASQGDGRTMFDFDAFYQAHYGEQLERERRLRARRE
ALRKKQKDHASKGPRWDDTRDATFFVILFLIFIFVGFRI
NT seq 660 nt   +upstreamnt  +downstreamnt
atggcggccgcgcgctgcctggcgtggccgctgtcatccctacggagattgtggcaggtc
cagggcttgcctcaaagttcggccacgggcttgtgctcacgagtgaggacttattcacgc
aacgctctctatgatcttctgggcgtcccctccaccgccacgcaggcacagatcaaagcg
gcgtactaccggcagagcttcctctaccatccggatcgcaatcccgggagcaccgaggct
gccgagcgcttcacgcgcatctccgaagcttatctggtcttgggcagtaccatcctccgt
cgcaagtatgaccgaggtttgctcagcgaccaggacctgcgcggacctggtgtcaagccc
tctaagacgccggtggccgatcccactcctccccgccctcctccctacacccctagggct
cacggtggctctcgggcttctcaaggcgacggccgcactatgttcgattttgacgccttc
taccaggcgcactatggagaacagctagagagggagcgtcgtctgcgcgcccggagggaa
gcccttcgcaaaaagcagaaggaccacgccagcaaggggccccgctgggacgatacccga
gatgccactttctttgtcatccttttccttatcttcatctttgtcggctttcgtatttaa

DBGET integrated database retrieval system