KEGG   Rattus norvegicus (rat): 369017Help
Entry
369017            CDS       T01003                                 

Gene name
Krt5, Krt2-5, Sak57
Definition
(RefSeq) keratin 5
  KO
K07605  type II keratin, basic
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:rno04812]
    369017 (Krt5)
   04147 Exosome [BR:rno04147]
    369017 (Krt5)
Cytoskeleton proteins [BR:rno04812]
 Eukaryotic cytoskeleton proteins
  Intermediate filaments
   Intermediate filaments
    Types I and II: Acidic and basic keratins
     369017 (Krt5)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   369017 (Krt5)
  Exosomal proteins of other body fluids (saliva and urine)
   369017 (Krt5)
  Exosomal proteins of colorectal cancer cells
   369017 (Krt5)
  Exosomal proteins of bladder cancer cells
   369017 (Krt5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Filament Keratin_2_head TPR_MLP1_2 AAA_13 Spc7 ATG16 CENP-F_leu_zip APG6_N Taxilin DHR10 Tropomyosin_1 Alanine_zipper TSNAXIP1_N Lebercilin Baculo_PEP_C Golgin_A5 Ax_dynein_light DUF745 DUF5082 T7SS_ESX_EspC T2SSM FliJ ISG65-75 Tektin COG5
Motif
Other DBs
NCBI-GeneID: 369017
NCBI-ProteinID: NP_899162
RGD: 727894
Ensembl: ENSRNOG00000050420
Vega: OTTRNOG00000001609
UniProt: Q6P6Q2
Position
7q36
AA seq 576 aa AA seqDB search
MSRQSSVSFRSGGSRSFSAASAITPSVSRTTFSSVSRSGGGGGRVSLGGAYGAGGYGSRS
LYNVGGSKRISFSSGGGSFRNQFGAGAGGGYGFGGGAGSGFGFGGGAGSGFGFRGGAGFG
GGYGGAGFPVCPPGGIQEVTVNQNLLTPLNLQIDPTIQRVRTEEREQIKTLNNKFASFID
KVRFLEQQNKVLDTKWTLLQEQGTKTIKQNLDPLFEQYINNLRRQLDGVMGERGRLDSEL
RNMQDLVEDYKNKYEDEINKRTTAENEFVMLKKDVDAAYMNKVELEAKVDALMDEINFMK
MFFDAELSQMQTHVSDTSVVLSMDNNRSLDLDSIIAEVKAQYEDIANRSRTEAESWYQTK
YEELQQTAGRHGDDLRNTKHEISEMNRMIQRLRSEIDNVKKQCANLQNAIAEAEQRGELA
LKDARNKLTELEEALQKAKQDMARLLREYQELMNTKLALDVEIATYRKLLEGQECRLSGE
GVGPVNISVVTNSLSSGYGGRSNIGYGFGLGSGIGGFASDIGPLLNRLGLGSGLSVGGSG
FSASSGQGGGFSSGGGSSSSVQFVSTTSSSRRSFNS
NT seq 1731 nt NT seq  +upstreamnt  +downstreamnt
atgtctcgccagtccagtgtgtccttccgaagcgggggcagccgctctttcagcgccgct
tctgccatcaccccatctgtctctcgtaccaccttcagctcggtgtcccgcagtggtggt
ggtggtggcagggtcagccttggtggcgcttacggagccgggggctatggcagccgaagc
ctgtacaatgtggggggctccaaaaggatctccttcagttctggcggaggtagcttcagg
aaccaatttggtgccggtgctggaggcggctatggctttggaggaggagcaggcagtgga
ttcggctttggtggtggagctggcagtggctttggcttccgtggtggagctggctttggt
ggtggctatggtggagctggcttccctgtgtgcccccctggtggcatccaagaggtcacc
gttaaccagaatctcctcacacccctgaacctgcaaatcgatcccaccatccagcgggtc
aggactgaggagagggagcagatcaagaccctcaacaacaagtttgcctccttcatcgac
aaggtgcggttcctggagcagcagaacaaggtcctggacaccaaatggaccctgctgcag
gagcagggcaccaagaccataaagcagaacctggatccgttgtttgaacagtacattaac
aacctccgtagacagctggatggggtcatgggggagaggggccgcctggactcggagctg
aggaacatgcaggatctggtggaggactacaagaacaagtacgaggatgagatcaacaag
cgtaccacggctgagaatgaattcgtgatgttgaagaaggatgtggacgcggcctacatg
aacaaggtggagctagaagctaaggttgatgccctaatggacgagatcaacttcatgaag
atgttctttgatgcggagctgtcccagatgcagacacatgtctctgacacatctgtggtc
ctctccatggacaacaaccgtagcctggacctggacagcatcatcgctgaggtcaaggcc
cagtacgaggacattgccaaccgcagccgaacagaggctgagtcctggtaccagaccaag
tacgaggagctgcagcagacagccggccggcacggagatgacctccgcaacaccaagcat
gagatctcagagatgaaccggatgatccagaggctgagatccgagatcgacaatgtcaag
aagcagtgtgccaacctccagaatgccatcgccgaggctgagcagcgtggggagctggct
ctcaaggatgccagaaacaagctgactgagctggaggaggccctgcagaaggccaagcag
gacatggcccggctgctgcgcgagtaccaggagctcatgaacaccaagctggccctggat
gtggagatcgccacctacaggaagctgctggagggacaggagtgcaggctgagtggagaa
ggagttggaccggtcaacatctctgtcgtcactaacagcctctcttctggctatggagga
agaagcaacattggctatggctttggtttgggcagtggcattgggggttttgcctcagat
atcggcccgctcttgaacaggctcggtttgggtagtgggctcagtgtggggggctccggc
ttcagtgcaagcagtggtcaaggtgggggtttcagcagtggtggtggcagcagctccagt
gtccaatttgtctccaccacctcctcctcccggaggagcttcaacagctaa

DBGET integrated database retrieval system