KEGG   Rattus norvegicus (rat): 373066Help
Entry
373066            CDS       T01003                                 

Gene name
Ift81, Cdv-1, Cdv1
Definition
(RefSeq) intraflagellar transport 81
  KO
K19677  intraflagellar transport protein 81
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rno03036]
    373066 (Ift81)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Intraflagellar transport (IFT) complex B
    373066 (Ift81)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IFT81_CH
Motif
Other DBs
NCBI-GeneID: 373066
NCBI-ProteinID: NP_954551
RGD: 727862
Ensembl: ENSRNOG00000001294
UniProt: P83829
Position
12q16
AA seq 675 aa AA seqDB search
MSDQIKFIVDSLNKEPFKKNYNLITFDSLGPMQLLQVLNDVLAEIDPKQDVDIREETPEQ
TAKRMLSLLGILKYKPPGNATDMSTFRQGLVIGSKPVIYPVLHWLLQRSSELKKRAYLAR
FLIKLEVPSEFLQDETVADTNKQYEELMEAFKALHKECEQLKTSGFSTAEIRRDISAMEE
EKDQLMKRVERLKKRVETVQNHQRMLKIARQLRVEKEREEFLAQQKQEQKNQLFHAVQRL
QRVQNQLKSMRHAAADAKPESLMKRLEEEIKFNSYMVTEKFPKELESKKKELHFLQKVVS
EPAMGHSDLLELESKVNEVNAEINQLIEKKMMRNEPIEGKLSLYRQQASIISRKKEAKAE
ELQETKEKLASLEREVSVKTNQTREFDGTEVLKGDEFKRYVSKLRSKSTVFKKKHQIIAE
FKAEFGLLQRTEELLKQRQETIQHQLRTIEEKKGISGYSYTQEELERVSALKSEVDEMKG
RTLDDMSEMVKKLNSLVSEKKSALAPVIKELRQLRQKCQLTQECDEKRTQYDSCAAGLES
NRSKLEQEVRGLREECLQEESKYHYTNCMIKNLEVQLRRATDEMKAYVSSDQQEKRKAIR
EQYTKNITEQENLGKKLREKQKAVRESHGPNMKQAKMWRDLEQLMECKKQCFLKQQSPAS
IGQVIQEGGEDRLVL
NT seq 2028 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaccaaatcaaattcatcgtggacagcctcaataaggagccttttaagaagaac
tataatttaatcacatttgattctttgggaccaatgcaactattacaagttctcaatgat
gtcctggctgagatagaccccaagcaagacgttgatatcagagaggagacgccggagcag
acagccaagcgcatgttgagccttcttggtatcctgaagtacaaacctccggggaatgcc
acagacatgagcaccttccgccagggtttggtgatcgggagtaaacctgtcatctacccg
gtgctccactggctcctccagcggagcagtgaactaaagaaaagggcgtatttagctcgc
ttcttaataaagctggaggtgcccagcgagtttctccaagatgaaaccgtggctgacacc
aacaaacagtatgaagagctgatggaagccttcaaagccctgcataaagagtgtgagcag
ctcaaaacatctggattctccacagcggagataagaagggatatcagcgcaatggaggag
gagaaagaccagctcatgaagagagttgaacggttgaagaagagggtggagactgtccag
aaccatcagcgaatgcttaaaatagcaagacagcttcgggttgagaaagagagagaagag
tttcttgctcaacagaagcaggaacaaaagaatcagctgtttcatgcggtgcagagattg
caaagagtgcaaaaccagctgaagagtatgcggcacgcggcagcagacgccaagcctgag
agtttaatgaagaggctagaggaggagataaaatttaattcatatatggtcactgaaaaa
tttccaaaagaattagaaagcaagaaaaaggaattacactttttacaaaaagtggtttct
gagccagctatgggccactctgaccttcttgaacttgagtctaaagtcaatgaagtaaac
gcagagatcaatcagttgattgagaaaaaaatgatgagaaacgagccaatagaaggcaag
ctctcactgtacaggcaacaggcgtccatcatttctcgtaagaaagaggccaaagctgag
gagctgcaggagaccaaggagaagctggccagcctcgagagagaggtgtctgtgaagaca
aaccagacccgggaatttgacggcactgaggttctgaagggagatgagttcaagagatac
gtcagtaaacttcggagcaaaagcacagttttcaaaaagaagcaccagataatagctgag
tttaaggctgaatttggcctcttgcagaggacagaagaacttctgaagcaacgtcaggaa
accattcaacatcaactgcgaaccattgaagagaagaagggcatctctggttacagctac
acccaagaggagcttgagagagtgtcggccctgaagagcgaggttgacgagatgaaaggc
cggaccctggacgacatgtcagagatggtaaaaaaactgaattccttggtatcagaaaag
aagtcagctttagccccagttataaaagaactacggcaattgcgtcagaaatgtcagcta
acccaggagtgtgatgagaagagaacccagtatgatagctgtgcggcaggccttgaaagc
aaccggtccaaattagagcaggaagtacgaggactccgtgaagaatgtcttcaagaagaa
agtaaataccattatacaaactgcatgattaagaacctagaagttcagcttcgccgagcc
actgatgagatgaaggcgtacgtctcttctgatcaacaagaaaagaggaaagcaattagg
gaacagtataccaaaaatattactgagcaagaaaacctgggcaagaaacttcgggaaaaa
caaaaggctgttcgagaaagtcacggtcccaacatgaagcaagcgaagatgtggcgggat
cttgaacaactgatggaatgcaaaaaacagtgctttctgaagcagcagagcccagcctcc
atcggccaggtaattcaggagggcggagaggaccggctggttctctga

DBGET integrated database retrieval system