KEGG   Rattus norvegicus (rat): 373542Help
Entry
373542            CDS       T01003                                 

Gene name
Stk25
Definition
(RefSeq) serine/threonine kinase 25
  KO
K08838  serine/threonine-protein kinase 24/25/MST4 [EC:2.7.11.1]
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    373542 (Stk25)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    373542 (Stk25)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     373542 (Stk25)
Protein kinases [BR:rno01001]
 Serine/threonine kinases: STE group
  STE20 family
   373542 (Stk25)
Membrane trafficking [BR:rno04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    373542 (Stk25)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Pkinase_fungal DUF1241 Kinase-like Haspin_kinase APH
Motif
Other DBs
NCBI-GeneID: 373542
NCBI-ProteinID: NP_908938
RGD: 727809
Ensembl: ENSRNOG00000018181
UniProt: Q6V9V9
Position
9q36
AA seq 426 aa AA seqDB search
MAHLRGFAHQHSRVDPEELFTKLDRIGKGSFGEVYKGIDNHTKEVVAIKIIDLEEAEDEI
EDIQQEITVLSQCDSPYITRYFGSYLKSTKLWIIMEYLGGGSALDLLKPGPLEETYIATI
LREILKGLDYLHSERKIHRDIKAANVLLSEQGDVKLADFGVAGQLTDTQIKRNTFVGTPF
WMAPEVIKQSAYDFKADIWSLGITAIELAKGEPPNSDLHPMRVLFLIPKNNPPTLEGHHS
KPFKEFVEACLNKDPRFRPTAKELLKHKFITRYTKKTSFLTELIDRYKRWKSEGHGEESS
SEDSDIDGEAEDGEQGPIWTFPPTIRPSPHSKLHKGTALHSSQKPAEPIKRQPRSQCLST
LVRPVFGELKEKHKQSGGSVGALEELENAFSLAEESCPGISDKLMVHLVERVQRFSHSRN
HLTSTR
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atggctcacctcaggggcttcgcgcaccagcattctcgtgtggacccagaggaactcttc
accaagcttgaccgaattggcaagggctcatttggggaggtgtacaaggggatcgacaac
cacacgaaggaggtggtggccatcaagatcattgacctggaagaggccgaggatgagatt
gaggacatccaacaggagatcaccgtgctcagccaatgtgatagcccttacatcactcgc
tacttcggctcctacctaaagagcaccaagctatggattatcatggagtacctgggtggt
ggctctgcactggacttgctgaaacctggtccactggaggagacctatattgccaccatc
ttgcgggagatcctgaaaggcttggattatctgcattcagagcgcaagatccaccgagac
atcaaagctgccaacgtgctgctctcagagcagggtgatgtgaagctggcagacttcggt
gtggctgggcagctcacagacacacaaatcaagaggaacacatttgtgggtactcccttc
tggatggcacctgaggttatcaagcagtcggcctatgacttcaaggctgacatctggtcc
ctgggcatcacagccatcgagctggccaagggggagccgccaaactctgacctccaccct
atgcgagtcctgttcctgattcccaagaacaatccacccacattggaaggccaccacagc
aaacccttcaaggagtttgtagaggcgtgcctcaataaggacccacgattccgacccact
gccaaggagctcctgaagcacaaattcatcacacgttacaccaagaagacctcctttctc
actgaacttattgaccgatataagcgttggaagtctgaggggcatggcgaggagtccagt
tctgaggattctgacattgatggcgaggctgaggatggggagcagggtcccatctggacg
tttcctccaaccatccggccaagtccacatagcaagctgcacaaggggactgctctgcac
agctcacagaagcctgctgagcctatcaagagacagccaaggtcccagtgcttgtccaca
ctagtccgtcctgtctttggagagctcaaagagaagcacaagcagagcggtgggagcgtg
ggtgccctggaggagctagagaatgccttcagcctggctgaggaatcctgtcctggcatc
tcagacaagctgatggtgcatctggtggagcgtgtgcagaggttctcacacagcagaaac
cacctgacatctacccgctga

DBGET integrated database retrieval system