KEGG   Rattus norvegicus (rat): 373544
Entry
373544            CDS       T01003                                 

Gene name
Ermp1, Fxna
Definition
(RefSeq) endoplasmic reticulum metallopeptidase 1
Organism
rno  Rattus norvegicus (rat)
SSDB
Motif
Pfam: Peptidase_M28 Peptidase_M20
Other DBs
NCBI-GeneID: 373544
NCBI-ProteinID: NP_908939
RGD: 727831
Ensembl: ENSRNOG00000010915
UniProt: Q6UPR8
Position
1q52
AA seq 898 aa
MEWSSESAAVRRHRGTAERREGQAAASHPQREASAQEDARGGGRMRGRTESGGESRGAKT
ALSEARTALALALYLLALRALVQLSLQRLVLSRTSGLQGEFDARQARVYLEHITAIGPRT
TGSAENEILTVQYLLEQITLIEEQSNSLHRISVDVQRPTGSFSIDFLGGFTSYYDNITNV
VVKLEPQDGAKYAVLANCHFDSVANSPGASDDAVSCAVMLEVLRVMAASPEPLQHAVVFL
FNGAEENVLQASHGFITQHPWASLIRAFINLEAAGVGGKELVFQTGPENPWLVQAYVSAA
KHPFASVVAQEVFQSGIIPSDTDFRIYRDFGNIPGIDLAFIENGYIYHTKYDTADRILID
SIQRAGDNILAVLKYLATSDMLASSSEYRHGSMVFFDVLGLLVIAYPSRVGSIINYMVVM
AVVLYLGRKLLRPNHSNSNYVRDFLCGLGITFISWFTSLVTVLIIAVFVSLIGQSLSWYN
YFYIAVCLYGTATVAKIILIHTLAKRFYYVNASDLYLGELFFDTSLFVHCGFLVALTAQG
FCSAFMSAVWVAFPLLTKLCVYKDFKKHGAKGRFIALYLLGMFIPYLYGLYLIWAVFEMF
TPILGRSGSEIPPDVVLASILAVCVMILSSYFITFIYLVNSTKKTILTLILVCAVTFLLV
CSGAFFPYSSNPDSPKPKRVFLQHVSRTFHNLEGSVVKRDSGIWINGFDYTGMSHVTPHI
PEINDTIRAHCEENAPLCGFPWYLPVHFLIRKNWYLPAPEISPRNPAHFRLVSKEKMPWD
SIKLTFEATGPSHMSFYVRTHKGSTLSQWSLGNGIPVTSRGGDYFVFYSHGLQASAWQFW
IEVQVSEEQPEGMVTVAIAAHYLSGENKRSSQLDALKEKFPDWSFPSAWVSTYSLFVF
NT seq 2697 nt   +upstreamnt  +downstreamnt
atggagtggagctcggagtcggcggccgtgcggcggcaccgcggcaccgcggagcggcgg
gagggtcaggcggccgcgtcgcacccgcagagagaggcctcagcgcaggaggatgcgagg
ggcggcgggaggatgcgggggaggacggagagcggcggcgagagccggggtgcgaagacc
gcgctgtccgaggcgcgcacggcgctggcgctcgcactctacctgctcgctctgcgggcg
ctcgtgcagctgtcgctgcagcggctggtgctgagccggacctcggggctccagggcgag
ttcgatgcgcgccaagccagggtttatctggaacacataacggccatcggccccaggact
acaggaagcgcagaaaatgaaatcctgacggtccagtaccttttggagcagatcacgctg
atagaagaacagagcaacagcctccacagaatctcagtagatgtacagcggcctaccggc
tcctttagcattgacttcttggggggctttacgagctactacgacaacattactaatgtc
gtggtgaagctggagccccaagatggagccaagtacgctgtcctggctaactgtcacttt
gactcagtggcaaattcaccaggtgccagtgacgatgccgttagctgtgcagtgatgctc
gaagtcctccgggtcatggcagcctctccagaacccctgcagcatgctgtggtgttcctc
tttaatggtgcagaggaaaatgtcttgcaagcaagccatggttttattactcaacatccc
tgggccagtttgattcgagcatttattaacctggaggctgcaggtgtcggagggaaagaa
cttgtgttccaaacaggccctgaaaatccttggctggttcaggcctatgtctcagcagct
aaacacccctttgcttctgtggtggcccaggaggtttttcagagtgggatcattccttct
gacaccgacttccgaatctacagggattttgggaacattccaggaatagacttagccttt
attgaaaatgggtacatctatcacaccaagtatgacacagcggacagaattctcatagat
tccattcagagagcaggtgacaacattttagcagttcttaaatacctagctacatctgac
atgctggcttcttcctctgagtaccgacatggaagcatggtcttcttcgatgtgcttggc
ctgctggtcattgcgtacccttctcgtgttggctccataataaactacatggtggtaatg
gctgttgttctgtacctgggaagaaaactgctgcggcccaatcacagtaattctaattat
gtgagagacttcttgtgcggacttggcatcactttcattagctggttcaccagccttgtt
acagttctcattatagcagtgttcgtctccctcattggacagtcgctctcatggtataac
tacttttatatcgccgtttgcctgtatggaactgcaacagtcgccaaaataatactcatt
catactcttgcaaaaagattttactatgtgaacgccagcgacctgtatctgggagaactg
ttctttgacacctcactgtttgtgcactgtggttttcttgttgctttaactgctcagggc
ttctgctctgcattcatgagtgctgtctgggtagcttttccattgctcacaaagctttgt
gtgtacaaggacttcaagaagcacggtgccaaaggaagatttattgctctttacttattg
gggatgttcatcccgtatctttatggactatacctcatctgggctgtatttgagatgttt
actcctatccttggaagaagcggttcggaaatccctcctgatgttgtgctagcatccatt
ttggctgtctgtgtgatgattctctcctcctattttattaccttcatctaccttgtgaac
agcacaaagaaaaccattctgactctaatactggtgtgtgcagtcacattcctccttgtg
tgcagtggggcctttttcccatacagctccaatcctgacagtccaaagccgaagagagtg
tttcttcagcacgtgagtagaacttttcataacttagaaggaagcgtagtaaaaagagac
tctggaatatggatcaatggttttgattatactggaatgtctcatgtaacaccgcacatt
ccggagatcaatgatacaatccgagctcactgtgaggagaacgccccgctctgtggcttc
ccttggtatctcccagtgcactttctcatcaggaaaaactggtatcttccagctccagaa
atttccccaagaaatcctgctcatttcagacttgtatccaaagagaagatgccttgggat
tcaataaagttgacctttgaagcaacaggaccaagccatatgtctttctatgttcgaacc
cacaaaggatcaacgctttctcagtggtctcttggcaacggcattccagtcacaagtcga
ggaggggactactttgtgttttactcccatggactccaggcttctgcgtggcagttctgg
atagaagtgcaggtctcagaggaacagccagaaggaatggtcactgtggccattgctgcc
cactatctatcaggggaaaacaagagatcatctcagctggatgctctgaaggagaagttc
ccagattggtcatttccctcggcgtgggtttccacctatagtctctttgtgttttaa

DBGET integrated database retrieval system