KEGG   Rattus norvegicus (rat): 373545Help
Entry
373545            CDS       T01003                                 

Gene name
Prkag2
Definition
(RefSeq) protein kinase AMP-activated non-catalytic subunit gamma 2
  KO
K07200  5'-AMP-activated protein kinase, regulatory gamma subunit
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04068  FoxO signaling pathway
rno04152  AMPK signaling pathway
rno04211  Longevity regulating pathway
rno04213  Longevity regulating pathway - multiple species
rno04371  Apelin signaling pathway
rno04530  Tight junction
rno04710  Circadian rhythm
rno04714  Thermogenesis
rno04910  Insulin signaling pathway
rno04920  Adipocytokine signaling pathway
rno04921  Oxytocin signaling pathway
rno04922  Glucagon signaling pathway
rno04931  Insulin resistance
rno04932  Non-alcoholic fatty liver disease (NAFLD)
rno05410  Hypertrophic cardiomyopathy (HCM)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    373545 (Prkag2)
   04068 FoxO signaling pathway
    373545 (Prkag2)
   04152 AMPK signaling pathway
    373545 (Prkag2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    373545 (Prkag2)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    373545 (Prkag2)
   04922 Glucagon signaling pathway
    373545 (Prkag2)
   04920 Adipocytokine signaling pathway
    373545 (Prkag2)
   04921 Oxytocin signaling pathway
    373545 (Prkag2)
  09149 Aging
   04211 Longevity regulating pathway
    373545 (Prkag2)
   04213 Longevity regulating pathway - multiple species
    373545 (Prkag2)
  09159 Environmental adaptation
   04710 Circadian rhythm
    373545 (Prkag2)
   04714 Thermogenesis
    373545 (Prkag2)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy (HCM)
    373545 (Prkag2)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    373545 (Prkag2)
   04931 Insulin resistance
    373545 (Prkag2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CBS Cbl_N3
Motif
Other DBs
NCBI-GeneID: 373545
NCBI-ProteinID: NP_908940
RGD: 727782
Ensembl: ENSRNOG00000009085
UniProt: Q6V7V4
Position
4q11
AA seq 326 aa AA seqDB search
MLEKLEFQEEEDSESGVYMRFMRSHKCYDIVPTSSKLVVFDTTLQVKKAFFALVANGVRA
APLWESKKQSFVGMLTITDFINILHRYYKSPMVQIYELEEHKIETWRELYLQETFKPLVN
ISPDASLFDAVYSLIKNKIHRLPVIDPISGNALYILTHKRILKFLQLFMSDMPKPAFMKQ
NLDELGIGTYHNIAFIHPNTPIIKALNIFVERRISALPVVDESGKVVDIYSKFDVINLAA
EKTYNNLDITVTQALQHRSQYFEGVVKCSKLETLETIVDRIVRAEVHRLVVVNEADSIVG
IISLSDILQALILTPAGAKQKETETE
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgctggagaagctggagttccaggaggaagaagactcagagagtggcgtttatatgcga
ttcatgaggtcacacaagtgttatgacatcgttccaaccagctcaaagcttgttgtcttc
gacactacgttgcaagttaaaaaggccttctttgctttggtagccaacggagtccgtgca
gcgccgctgtgggaaagtaaaaagcagagcttcgtaggaatgctcacaattacagatttc
ataaacatactacacagatactataaatcccccatggtacagatttatgaattggaggaa
cataagattgaaacgtggagggaactgtacttacaagaaaccttcaagcctttggtgaat
atctctccagatgcgagcctcttcgatgctgtatactcgttgatcaaaaataaaatccac
agattgccagttattgaccctatcagtgggaatgcactttatatacttacccacaaaaga
atcctcaagttcctccagctttttatgtctgacatgccaaagcccgccttcatgaagcag
aacctggatgagctcggaataggaacatatcacaatattgccttcattcacccgaatacc
cccatcatcaaagccttgaacatctttgtggagagacggatatctgcgctgcctgtggtg
gatgagtcaggaaaagttgtagatatttactccaagtttgatgtaattaatcttgctgct
gagaaaacgtacaataacctagacatcacggtgacccaggccctgcagcaccgctcacag
tattttgagggtgtggtcaagtgcagtaagctggaaacactggagaccattgtggacaga
atagtgagagccgaggtccatcggttggtggtagtgaatgaagcagatagtattgtgggt
attatctccctgtcagacatcctgcaagccctgatcctcacaccagcaggtgccaaacag
aaggagacagagaccgaatga

DBGET integrated database retrieval system