KEGG   Rattus norvegicus (rat): 378939Help
Entry
378939            CDS       T01003                                 

Gene name
Uts2b, U2B, Urp, Uts2d
Definition
(RefSeq) urotensin 2B
  KO
K05248  urotensin 2
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    378939 (Uts2b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Urotensin_II
Motif
Other DBs
NCBI-GeneID: 378939
NCBI-ProteinID: NP_937766
RGD: 727977
Ensembl: ENSRNOG00000038512
UniProt: Q765I2
Position
11q22
AA seq 118 aa AA seqDB search
MKFFSTSLCFGLLALLSVTTLLHSVRGRPHLSSGHELFPAEEHTTQEKLPLGLLIRNPGF
QRPAHAGVDLPSKVEELRQLKKLREWFMEAKSAEPSNALDKLSSSHPIKRACFWKYCV
NT seq 357 nt NT seq  +upstreamnt  +downstreamnt
atgaagttcttctcaacttctctctgctttggactcctggctttgttgtctgtgacgacc
cttttacattctgtacgtggacggccgcatctgagctcaggacatgagttatttccagct
gaagaacacacgactcaggagaaactaccgctgggtctgctgatccgaaaccctggtttc
cagaggcccgcccatgctggtgtagatttgcccagcaaagtggaagaacttagacagcta
aagaagctgagagaatggtttatggaggcaaagagtgctgagccgtccaatgctttagac
aagctatcctcttcccaccctattaaacgagcttgcttttggaaatactgtgtctga

DBGET integrated database retrieval system