KEGG   Rattus norvegicus (rat): 378947Help
Entry
378947            CDS       T01003                                 

Gene name
Bst2, DAMP-1, Damp1
Definition
(RefSeq) bone marrow stromal cell antigen 2
  KO
K06731  bone marrow stromal cell antigen 2
Organism
rno  Rattus norvegicus (rat)
Pathway
rno05168  Herpes simplex virus 1 infection
rno05170  Human immunodeficiency virus 1 infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    378947 (Bst2)
   05168 Herpes simplex virus 1 infection
    378947 (Bst2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:rno04090]
    378947 (Bst2)
CD molecules [BR:rno04090]
 Proteins
  378947 (Bst2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: BST2 FapA Paralemmin HemX Fib_alpha TraF_2 MCU Cob_adeno_trans Laminin_I DUF677 DUF3450 ATG16 FlaC_arch FliJ Shugoshin_N RskA Fzo_mitofusin CRA FemAB Neurensin GrpE Uso1_p115_C L_lactis_ph-MCP DUF1664 YPEB DUF898 DUF724 AAA_13 Exonuc_VII_L Spc7 p31comet TMF_DNA_bd DUF4200 Init_tRNA_PT DUF3810 Cluap1 DUF4795 LUC7 CitMHS PRKG1_interact 7tm_7 V_ATPase_I Laminin_II PKcGMP_CC NPV_P10 NRBF2 UPF0242 I_LWEQ FliD_N Phage_GPO DUF4381 PspA_IM30 IFT20 Ribosomal_L29 ABC_tran_CTD Prefoldin bZIP_2
Motif
Other DBs
NCBI-GeneID: 378947
NCBI-ProteinID: NP_937767
RGD: 727849
UniProt: Q811A2
Position
16p14
AA seq 172 aa AA seqDB search
MAPSFYHYLPVAMDERWEPKGWSIRRWWLVAAILVVLIGVVLVCLIVYFANAAHSEACKN
GLRLQDECRNTTHLLKHQLTRAQDSLLQTEMQANSCNQTVMDLRDSLKKKVSQTQEQQAR
IKELENKIERLNQELENLRTQKEISTTVQVNSGGSVVVSSLLVLVAVLFLHF
NT seq 519 nt NT seq  +upstreamnt  +downstreamnt
atggcaccctctttctaccactatctgcccgtggcgatggacgagaggtgggagccaaaa
ggatggagcatccgccggtggtggctggtggccgcaatcttggtggtcctgatcggggtt
gtcttagtctgcctgatagtctacttcgccaacgcagcgcacagcgaggcctgtaagaac
gggttgcggttgcaggatgagtgccgaaacaccacgcacctgttgaagcaccagctcacc
cgcgcccaggacagcctgctgcagacggagatgcaggcaaactcctgcaaccagaccgtg
atggaccttcgggattccctgaagaagaaggtgtctcaaacccaggagcagcaggcccgc
atcaaggaacttgagaataagatcgagaggctgaaccaggagctggagaatctgaggacc
caaaaggaaatttctaccacagtgcaggtgaactcaggcggctccgtggtggtctccagc
ctactggtgcttgtggcggtactgttcctgcacttttga

DBGET integrated database retrieval system