KEGG   Rattus norvegicus (rat): 399475Help
Entry
399475            CDS       T01003                                 

Gene name
Adm2, Imd
Definition
(RefSeq) adrenomedullin 2
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: Calc_CGRP_IAPP
Motif
Other DBs
NCBI-GeneID: 399475
NCBI-ProteinID: NP_958829
RGD: 1302971
Ensembl: ENSRNOG00000029830
UniProt: P61312
Position
7q34
AA seq 146 aa AA seqDB search
MAQLLMVTVTFGCISLLYLLPGTLSGSLGKGLRPREPPAKIPSSGPQPGHPSLRPVVWKP
PHALQPQGRGNPALATVHLPQGGGSRHPGPQRHVGSRRPHAQLLRVGCVLGTCQVQNLSH
RLWQLVRPSGRRDSAPVDPSSPHSYG
NT seq 441 nt NT seq  +upstreamnt  +downstreamnt
atggcccagttgctgatggtcacggtaaccttcggttgcatcagcctcctctacctgctc
ccgggcacgctgtctggcagcctgggtaagggactgagacccagagaacccccagccaag
attccttccagcggcccacagcctggacacccctcacttcggcctgtagtctggaagcct
ccacatgctctccagccacagggaaggggcaacccggcccttgctacggttcatctgcct
cagggtggtggctcacgacacccaggtccccagcgtcacgtgggatcccgaagaccccat
gcccagctccttcgggttggctgtgtcctgggaacgtgtcaagtccagaatctcagccat
cgcctgtggcaacttgtccggccaagtggccggcgggactcagctcctgtggatcccagc
agcccccacagttatggctga

DBGET integrated database retrieval system