KEGG   Rattus norvegicus (rat): 404645Help
Entry
404645            CDS       T01003                                 

Gene name
Mrgprx2l, MrgB2, Mrgprb2
Definition
(RefSeq) MAS-related G protein-coupled receptor, member X2-like
  KO
K08396  Mas-related G protein-coupled receptor member X
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rno04030]
    404645 (Mrgprx2l)
G protein-coupled receptors [BR:rno04030]
 Rhodopsin family
  Others
   Mas proto-oncogene and Mas-related (MRGs)
    404645 (Mrgprx2l)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1
Motif
Other DBs
NCBI-GeneID: 404645
NCBI-ProteinID: NP_001002285
RGD: 738053
Ensembl: ENSRNOG00000022729
UniProt: Q7TN47
Position
1q22
AA seq 314 aa AA seqDB search
MSSCGIMSCTMIFLSLIIAIVVLVGNAIVIWLLGFQMCRNAFSIYILNLAGADFLFIGFQ
IGYCFYIIFDIYTIPIKLPLFFIVMLNFAYLCGLSILSAVSIERCLCVMRPFWYRCQLPR
HTSAVICTMLWVLSLVLSLSEGKECGFLPGTNISDWCKTIDLIITSWLIVLFVVLLVSSL
ALVITIFCGLYRIPVTRLYVVIVFTVLFFLLFGLPYGIYLFLLVWAETFYYVFPCGFLPV
TIFLSCINTCANPIIYFLVGSVRHHRFQRKSLKLLLQQARQDTPETEEYVEMGSLGRSRE
VNSLQGTESCFDQA
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atgtcatcatgtggcataatgtcttgtaccatgatatttctttccctcatcattgctata
gttgttctggttggaaatgccatagtgatatggctcctgggcttccagatgtgcaggaat
gccttctctatctacatcctcaacctggctggtgctgactttctcttcattgggtttcaa
attggatattgtttttatattatctttgacatctacaccatcccgattaaattgcctctg
tttttcattgttatgttaaactttgcttatctttgtggcctgagcattctcagtgctgtt
agtattgaacgctgcctgtgtgtcatgaggccattctggtatcgctgccaacttccaagg
catacatcagctgtcatatgtaccatgctttgggtcttgtccctagtgttgagcctttca
gaaggaaaagaatgtggcttcctacctggcactaacatctctgattggtgtaagacaatt
gatttaatcattacttcatggctaattgttttatttgtggttctcttggtgtccagtttg
gccttggtgattactatcttctgtggcttatacaggattcctgtgaccaggctgtatgtg
gtcattgtgttcacagtgttgttcttcctgctctttggtctgccctatgggatttatttg
ttcctcttagtgtgggctgagacattttattatgtttttccttgtggttttcttccagtg
acaatatttctatcctgtattaacacctgtgccaaccccatcatttacttcctcgtaggc
tccgttaggcatcatcggtttcaacggaagtctctcaagctacttctgcagcaggccagg
caagacactcctgagacagaagaatatgtagaaatgggctccttaggaagatctagagaa
gtaaacagtctgcaagggactgagagctgctttgaccaggcataa

DBGET integrated database retrieval system