KEGG   Rattus norvegicus (rat): 404646Help
Entry
404646            CDS       T01003                                 

Gene name
Mrgprc, MrgC, Snsr
Definition
(RefSeq) MAS-related G-protein coupled receptor, member C
  KO
K08396  Mas-related G protein-coupled receptor member X
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rno04030]
    404646 (Mrgprc)
G protein-coupled receptors [BR:rno04030]
 Rhodopsin family
  Others
   Mas proto-oncogene and Mas-related (MRGs)
    404646 (Mrgprc)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srx
Motif
Other DBs
NCBI-GeneID: 404646
NCBI-ProteinID: NP_001002286
RGD: 738054
UniProt: Q8R4G1
AA seq 323 aa AA seqDB search
MDPTISSLSTESTTLNKTGHPSCRPILTLSFLVPIITLLGLAGNTIVLWLLGFRMRRKAI
SVYVLNLSLADSFFLCCHFIDSLMRIMNFYGIYAHKLSKEILGNVAFIPYISGLSILSAI
STERCLSVLWPIWYHCHRPRNMSAIICVLIWVLSFLMGILDWFFSGFLGETHHHLWKNVD
FIVTAFLIFLFMLLFGSSLALLVRILCGSRRKPLSRLYVTISLTVMVYLICGLPLGLYLF
LLYWFGIHLHYPFCHIYQVTVLLSCVNSSANPIIYFLVGSFRHRKKHRSLKMVLKRALEE
TPEEDEYTDSHVQKPTEISERRC
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atggatccaaccatctcatccctcagtacagaatctacaacactgaataaaactggtcat
cccagttgcaggccaatcctcaccctgtccttcctggtccccatcatcaccctgcttgga
ttggcaggaaacaccattgtactctggctcttgggattccgcatgcgcaggaaagccatc
tcagtctacgtcctcaacctgtctctggcagactccttcttcctctgctgccattttatt
gactctctgatgcggatcatgaacttctatggcatctatgcccataaattaagcaaagaa
atcttaggcaatgtagcattcattccctatatctcaggcctgagcatcctcagtgctatc
agcacggagcgctgcctgtctgtattgtggccaatctggtaccactgccaccgcccaaga
aacatgtcagctattatatgtgttctaatctgggttctgtcctttctcatgggcatcctt
gactggttcttctcaggattcctgggtgagactcaccatcatttgtggaaaaatgttgac
tttattgtaactgcatttctgatttttttatttatgcttctctttgggtccagtctggcg
ctactggtgaggatcctctgtggttccagacggaaaccactgtccaggctgtacgttaca
atctctctcacagtgatggtctacctcatctgcggcctgcctctcgggctttacttgttc
ctgctatattggtttgggatccatttacattatcccttttgtcacatttaccaagttact
gtgctcctgtcctgtgtgaacagctctgccaaccccatcatttacttccttgtagggtcc
tttaggcaccgtaaaaagcatcggtccctcaaaatggttcttaagagggctctggaggag
actcctgaggaggatgaatatacagacagccatgttcagaaacccactgagatctcagaa
aggagatgttga

DBGET integrated database retrieval system