KEGG   Rattus norvegicus (rat): 404794Help
Entry
404794            CDS       T01003                                 

Gene name
Olr782
Definition
(RefSeq) olfactory receptor 782
  KO
K04257  olfactory receptor
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    404794 (Olr782)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rno04030]
    404794 (Olr782)
G protein-coupled receptors [BR:rno04030]
 Others
  Chemoreception
   Olfactory
    404794 (Olr782)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_4 7tm_1 7TM_GPCR_Srx
Motif
Other DBs
NCBI-GeneID: 404794
NCBI-ProteinID: NP_001000605
RGD: 1333867
Ensembl: ENSRNOG00000047084
UniProt: M0R4N0
Position
3q34
AA seq 312 aa AA seqDB search
MYGMNRSAVSEFIFLGITNIWEVQGLLFFFTLLFYFASMIGNLVIVLTVSLDPHLNSPLY
FLLANLSVIDMMFCSITAPKMICDIFKKHKTISFWGCITQIFFSHAVGGTEMVLLIAMAF
DRYVAICKPLHYLIIMSPRVCLFFLVTSWVIGLIHSMVQLVFVVDLPFCGPNTLDSFYCD
LPRLLRLACTNTEELELMVTVNSGFISVGSFLLLVISYIFILFTVWKHSSGGLSKALSTL
SAHITVVILFFGPLMFFYTWPSPTSHLDKYLAIFDAFITPFLNPVIYTFRNKDMKVAMGR
LWAYFRHYRKMS
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atgtatggaatgaatcgctctgcagtatcagagtttatattcctcgggatcactaatata
tgggaggttcagggtttactttttttcttcaccttgctgttctactttgcaagtatgatt
ggcaaccttgtcattgtgctcacggtaagcttggatcctcatctaaactcccccctgtat
ttcctcttagctaatctctcagtcattgatatgatgttctgctcaattacagctcctaag
atgatctgtgacatttttaagaaacacaaaaccatctccttctggggatgtataactcag
atcttcttcagtcatgctgttgggggcactgagatggtactgctcatagccatggccttt
gacagatatgtagccatatgtaagcctctgcattacctgatcatcatgagcccacgagtg
tgtctattctttttagtcacctcctgggtcattggtcttattcactcaatggtacaacta
gtgtttgttgtagacttgcctttctgtggtcctaatacattggacagtttttactgtgac
ctgccccgactcctcagacttgcctgcacaaacactgaagagcttgagctcatggtcact
gtcaacagtgggttcatttctgtggggtcctttcttctactggtcatttcctatattttc
attctattcactgtttggaaacattcttctggtgggttatctaaagccctttccactctc
tcagcccatatcactgtggtcatcttgttctttgggccactgatgtttttctatacatgg
ccttcaccaacatcacaccttgataagtatcttgctatctttgatgcatttatcactccc
tttttgaatccagtcatctatacattcaggaacaaagacatgaaagtggcaatggggaga
ctgtgggcctattttaggcattacaggaaaatgtcataa

DBGET integrated database retrieval system