KEGG   Rattus norvegicus (rat): 404804Help
Entry
404804            CDS       T01003                                 

Gene name
Olr749
Definition
(RefSeq) olfactory receptor 749
  KO
K04257  olfactory receptor
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    404804 (Olr749)
G protein-coupled receptors [BR:rno04030]
 Others
  Chemoreception
   Olfactory
    404804 (Olr749)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_4 7tm_1 7TM_GPCR_Srx
Motif
Other DBs
NCBI-GeneID: 404804
NCBI-ProteinID: NP_001000615
RGD: 1333136
Ensembl: ENSRNOG00000049966
UniProt: D4A8Q7
Position
3q34
AA seq 312 aa AA seqDB search
MNEINYTKVSEFVFLGLSKSKEIQHFFLAFSVVLYVAIVLGNTLVVFTLALDPHLHSPMY
FLLGNLSFIDLCFSTLTVPKMISDLSSGHNTISFHGCVFQIFVIHVLGASEMVLLVVMAW
DRYVAICKPLHYLTIMNPRICILLLSGAWIIAFLHSVIQLGFVVHLRFCGPNEIDSFYCD
LPRFIKLACMDNYRMEFMVAANSGIISIGTFFLLIISYIVILLTVRKHSSGDLSKALSTL
SAHISVVVLFFGPCIFVYMWPFPTVPVDKFLAILDFMITPILNPAIYTLRNKDMKVAMRK
LSVQLLHFRKMS
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atgaatgaaataaattacaccaaggtttctgaatttgtgtttctgggactttcaaaatct
aaagaaatacaacatttcttccttgccttctctgtggtattatatgtagccatcgtactg
ggcaatacccttgttgtgtttacactagcattggacccacatttacattcccctatgtat
tttcttttaggaaacctctcatttattgatttatgtttttccaccttaactgtacccaag
atgatttctgacttgtcgtctgggcacaataccatctcattccatggttgtgtcttccag
atatttgtcattcatgtccttggggcttctgagatggtattgctggtagtcatggcctgg
gacagatatgtagccatatgtaaacccctccactatttaaccatcatgaacccacggatt
tgcattttgcttctatctggggcttggattattgcatttttgcattcagtgatccaactt
ggttttgttgtccatttgaggttttgtggtccgaatgagatagatagtttttactgtgat
cttcctagattcatcaagctggcctgcatggacaactacagaatggagttcatggtggct
gccaacagtggcatcatttctattggcaccttcttcttattgattatctcctacattgtt
atcctgctcactgtgaggaaacattcatcaggagatttgtccaaggccctctcgacactt
tctgctcacatctctgtggtagttttgttctttggaccatgcatctttgtatacatgtgg
ccatttcctacagtgccagtggataagttccttgccattctggacttcatgattacaccc
atcctgaaccctgccatttacacactgaggaacaaagacatgaaggtggcaatgaggaaa
ctaagtgttcagctcctgcattttaggaaaatgtcctga

DBGET integrated database retrieval system