KEGG   Rattus norvegicus (rat): 404862Help
Entry
404862            CDS       T01003                                 

Gene name
Olr582
Definition
(RefSeq) olfactory receptor 582
  KO
K04257  olfactory receptor
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    404862 (Olr582)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rno04030]
    404862 (Olr582)
G protein-coupled receptors [BR:rno04030]
 Others
  Chemoreception
   Olfactory
    404862 (Olr582)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_4 7tm_1
Motif
Other DBs
NCBI-GeneID: 404862
NCBI-ProteinID: NP_001000662
RGD: 1333782
Ensembl: ENSRNOG00000046448
UniProt: D3Z8G1
Position
3q24
AA seq 310 aa AA seqDB search
MDKENCSSLPDFFLLGISRNPDMKRALFVVFLVVYLTILVANAGMIVLIRIDPQLHTPMY
FFFSQLAFSDLCYSTAVGPKMLLDLITENNPISFVGCFLQFLLVCTFIDIECMLLAVMAF
DRYKAISTPLLYAVDMSNRVCYQFLTGIYVLGTIDGFIHTSLAFSLCFCGSTHINQFFCD
FPAVLLISCSDTQINELVLFILFGFIELSTISSVLVSYCYIISSVLKISSAGGRFKAFST
CASHLTAVGIFQGTMLFMYFRPSSAYSLDQDKMTSVFYLLIIPMINPLIYSLRNKDVKEA
LVRLRKKRWF
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atggataaggaaaactgctcttcattaccagattttttcctcctgggaatttccagaaac
cctgacatgaagagagctttatttgttgtgtttctggttgtttatcttactattcttgta
gcaaatgctggaatgatcgttttgatcagaatagatccccagcttcacacaccaatgtac
ttcttcttcagccaacttgccttctctgacttgtgctattccactgcagtgggaccaaag
atgctattggacctcattacagagaataatccaatttcatttgttggctgtttcctgcaa
ttcttattagtttgtacctttatagatattgaatgcatgcttctggcagtaatggccttt
gataggtacaaggccatcagtacacccctgttgtatgctgtggacatgtctaacagagtt
tgttaccagtttctaactggaatctatgtgttgggaactatagatggtttcatacataca
tcattggcattcagcttatgtttctgtggctctactcatattaatcaatttttctgtgat
tttcctgctgttttactcatttcctgttctgatacgcagatcaatgaactggtgctattc
atcctttttggtttcattgaactgagcactatctcaagtgtcctggtctcttattgttac
atcatctcatcagtcttaaagatcagctctgcagggggacgcttcaaagctttctccacc
tgtgcatcccacctgactgcagtagggattttccaggggaccatgctcttcatgtatttc
agaccaagttctgcctactctctagaccaagacaaaatgacatcagttttttacctcctc
attatcccaatgataaaccctttgatttacagcctaaggaacaaggatgtgaaagaagcc
ctggtcaggctcagaaagaaaaggtggttttaa

DBGET integrated database retrieval system