KEGG   Rattus norvegicus (rat): 404989Help
Entry
404989            CDS       T01003                                 

Gene name
Olr268
Definition
(RefSeq) olfactory receptor 268
  KO
K04257  olfactory receptor
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    404989 (Olr268)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rno04030]
    404989 (Olr268)
G protein-coupled receptors [BR:rno04030]
 Others
  Chemoreception
   Olfactory
    404989 (Olr268)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_4 7tm_1
Motif
Other DBs
NCBI-GeneID: 404989
NCBI-ProteinID: NP_001000733
RGD: 1333901
Ensembl: ENSRNOG00000053711
UniProt: A0A0G2KAI4
Position
1q33
AA seq 314 aa AA seqDB search
MAFQEDGNHTTVTEFILLGLTDDPVLRVVLFTIILCIYLVTVSGNLSTILLIRVSSQLHH
PMYFFLSHLGSADIGYSSSVTPNMLVSFLVKKNTITTLGCGIQLGSGAFFGTVECFVLAA
MAYDRFVAICSPLLYSTKMSTQVCVQLLVVAYISGFLNASSFTLSFFSFFFCGPNRINHF
FCDFTPLVELSCSEDSVFIILVTISSGTVIVITVLIIAVSYIYILITILKMRSTGSRHKA
FSTCTSHLTAVTLFYGTVTLIYLMPKSSYSTDQNKVVSVFYIVVIPMLNPLIYSLRNNEI
KDALKRHIGRKTCS
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atggctttccaagaggatgggaaccacacaacagtgacagagttcattttattgggctta
acagatgacccagttcttagagttgtcctcttcaccatcatcctgtgcatctacctggtg
actgtgtctgggaacctcagcaccatccttctcatcagagtctcatctcagctccatcac
cccatgtacttttttctcagccacttgggttctgctgatataggctactcatcttctgtc
acacccaatatgcttgttagcttcctggtgaagaaaaataccattaccaccctagggtgt
ggcatccagcttggctcaggtgctttctttgggacagttgagtgctttgttctagctgcc
atggcttatgatcgctttgtggcaatctgtagtccactgctttattcaaccaaaatgtca
acacaagtctgtgtccagttgcttgtagtagcatacataagtggttttctgaatgcttcc
tcctttaccctttcatttttttctttcttcttttgtggaccaaatagaatcaaccatttt
ttttgtgattttactcctttagttgagctctcctgttctgaggacagtgtctttattatt
cttgtcacaatttctagtggtactgtcattgtgatcacagtgcttatcatagctgtctcc
tatatctatatcctcatcaccattctgaagatgcgctccactgggagccgccacaaggcc
ttctccacctgcacctcccacctcacagcagtcactctgttctatggtactgtcacactc
atctacctgatgcccaagtctagctactctacggaccagaacaaggtggtgtctgtgttc
tacatagtggtgatccccatgttgaatccactcatctatagcctcagaaataatgaaatt
aaagatgctcttaagagacatataggcaggaaaacatgttcatag

DBGET integrated database retrieval system