KEGG   Rattus norvegicus (rat): 405007
Entry
405007            CDS       T01003                                 

Gene name
Olr110
Definition
(RefSeq) olfactory receptor 110
  KO
K04257  olfactory receptor
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    405007 (Olr110)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rno04030]
    405007 (Olr110)
G protein-coupled receptors [BR:rno04030]
 Others
  Chemoreception
   Olfactory
    405007 (Olr110)
SSDB
Motif
Pfam: 7tm_4 7tm_1 7TM_GPCR_Srsx
Other DBs
NCBI-GeneID: 405007
NCBI-ProteinID: NP_001000743
RGD: 1333316
Ensembl: ENSRNOG00000015924
UniProt: D4ABG1
Position
1q32
AA seq 321 aa
MTTPSTILNYTNVRDIWYTMIGIPGLEESHIWISIPICSMYIVAIAGNALLLFLIITERS
LHEPMYLFLSMLALADIFLSTVTTPKMLAIFWFQAAGISFASCVSQMFFLHFIFVAESAI
LLAMAFDRYVAICYPLRYTTILTPSVIIKMGIASVIRSFFICFPLIFLVYRLTYCGKNII
RHSYCEHMGIARLACDSIKVNIYYGVIVALFSTCLDVVLIIVSYALILCSVFRIPSRDAR
LKALGTCGSHVCVILLFYTPAFFSFFAHRFGGHSIPLHVHILLANLYVVVPPSVNPIIYG
VKTKQIQERVIQVFSLGKSFC
NT seq 966 nt   +upstreamnt  +downstreamnt
atgacaacaccttcaaccattttaaattacaccaacgtcagagacatctggtacaccatg
attgggatcccaggactagaagagtcacacatatggatctccatccccatctgttcaatg
tacatagtggccattgcaggcaatgccctgctattattcctgatcatcactgaacgcagc
cttcacgaacccatgtaccttttcctgtccatgttggcactggctgatatctttctgtct
acagtcacaacaccaaaaatgttagcaatcttctggttccaagctgcaggcatttccttc
gctagttgtgtatctcagatgtttttcctccacttcatcttcgtggcagagtctgccata
ctgctggctatggcatttgaccgttatgtggccatctgctatccactaagatacaccacc
attctaaccccatctgtcatcatcaaaatgggcattgcatctgtgattagaagcttcttc
atctgcttccctctgatcttccttgtttataggctcacctattgcgggaagaacatcatt
cgtcactcatactgtgaacacatgggcattgccaggttggcctgtgacagcatcaaggtc
aatatttactatggtgtgatagtggctctgttttccacatgcctagatgttgtgctgatc
attgtctcatatgcccttatcctttgttctgtgtttagaattccttctcgagatgcccgg
ctcaaggctctaggtacttgtggttcccatgtttgtgttattcttctgttctatacacca
gcgttcttctctttctttgctcatcgttttgggggtcacagtataccgctgcatgtgcat
attctccttgccaacctctatgtggtagtcccacccagtgtcaaccccatcatttatgga
gtgaagacgaaacaaattcaggagagggttatccaagtcttttctttgggcaagtcattt
tgttga

DBGET integrated database retrieval system