KEGG   Rattus norvegicus (rat): 405050
Entry
405050            CDS       T01003                                 

Gene name
Olr1449
Definition
(RefSeq) olfactory receptor 1449
  KO
K04257  olfactory receptor
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    405050 (Olr1449)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rno04030]
    405050 (Olr1449)
G protein-coupled receptors [BR:rno04030]
 Others
  Chemoreception
   Olfactory
    405050 (Olr1449)
SSDB
Motif
Pfam: 7tm_4 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx
Other DBs
NCBI-GeneID: 405050
NCBI-ProteinID: NP_001000775
RGD: 1332774
Ensembl: ENSRNOG00000046934
UniProt: D3Z867
Position
10q22
AA seq 306 aa
METGNHSCKTDFTLVGLFQCGHTDTFLFTVITLLFAVALIGNITLVHLIRLDRTLHTPMY
FLLSQLSIIDMMYISTTVPKMAANFLSNTKTISFLGCAIQTFVFLTLGGSEALLLGFMSY
DRYIAICWPLHYPLLMSRKICCSMVASAWSSSSITALMHIIYIFQLPFCGSKIVNHFFCE
VPSLLPLVCEDTSQYEHLIVMSVLILVLIPFLAILASYAQVLVVVFRMGSGKGQSKAVST
CSSHLTVASLFYVTGLCTYTQPHSLHSPGRDKVVAVVYSIITPVLNPFIYSLRNKEVMGA
LRRQMG
NT seq 921 nt   +upstreamnt  +downstreamnt
atggagacaggaaaccacagctgtaagacagacttcaccttggttggtcttttccagtgt
ggacacacagacaccttcctcttcacagtcattaccctcctatttgcagtggctctcata
ggcaacatcacactggtccatctcatcaggctggaccgaacactccacacccccatgtac
ttcctcctcagccagctctccatcatcgacatgatgtacatctccaccacggtgcccaag
atggcagctaacttcctgtcaaacactaagaccatttcctttctgggatgcgcaatccaa
acctttgtgtttctgaccctgggtgggtctgaagccctcctgctgggtttcatgtcctat
gacaggtacatagccatctgctggcccttgcactaccctttgctcatgagcagaaagatc
tgctgctccatggtcgccagtgcctggagcagtagctccatcactgcgttaatgcacata
atctatatatttcaacttccattctgtggatctaagattgttaaccactttttctgtgag
gttccatctctcctgccactggtgtgtgaagacacgtcccaatatgagcatttgattgtc
atgagtgtccttattcttgtactgatacctttcctggccatcctagcttcctatgctcag
gtattggttgttgtattccggatgggttcagggaagggacagagtaaagctgtgtccacc
tgctcttcccacctgactgtggccagcctgttctatgtcactggtctttgcacctacacc
cagccacattctttgcattctcctgggagggacaaagtggtagctgtggtctactctatc
atcacccctgttctgaacccgttcatctacagcctgaggaacaaggaggtcatgggggcc
ctgaggagacaaatgggatga

DBGET integrated database retrieval system