KEGG   Rattus norvegicus (rat): 405051
Entry
405051            CDS       T01003                                 

Gene name
Olr1442
Definition
(RefSeq) olfactory receptor 1442
  KO
K04257  olfactory receptor
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    405051 (Olr1442)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rno04030]
    405051 (Olr1442)
G protein-coupled receptors [BR:rno04030]
 Others
  Chemoreception
   Olfactory
    405051 (Olr1442)
SSDB
Motif
Pfam: 7tm_4 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx
Other DBs
NCBI-GeneID: 405051
NCBI-ProteinID: NP_001000776
RGD: 1332943
Ensembl: ENSRNOG00000031246
UniProt: D3ZGR8
Position
10q22
AA seq 304 aa
MGTGNHSCGTDFTLVGLFQYGHMDTFLFTIITLLFAVALMGNITLVYLIRLDRILHTPMY
FLLSQLSIIDMMYISTTVPKMAMNSLSDTKTISFLGCAIQTFLFLTLGGSEALLLGFMSY
DRYIAICQPVHYPVLMSRKICCSIVTSTWSSSSITALMHIIYLFQLPLCGSRINHFFCEV
PSLLPLVCEDTSQYEHAVLMSGLVILLLPFLAILASYARVLVVFQMGSGKGQSRAVSTCS
SHLTVASLFYITTLSTYTQPHTLHSPGRDKVVAVIYSIVTHVLNPFIYSLRNKEVMWALK
RQMG
NT seq 915 nt   +upstreamnt  +downstreamnt
atggggacaggcaaccacagctgtgggacagacttcaccttggttggtctattccagtat
ggacacatggacactttcctctttacaatcatcaccctcctctttgcagtggctctcatg
ggcaacatcacactagtctacctcatcaggctggaccgaatactccacacccccatgtac
ttcctcctcagccagctctccatcattgacatgatgtacatctccaccactgtgcccaag
atggcaatgaactccttgtcagacaccaagaccatttcttttctgggatgtgcaatccaa
acctttttatttctgaccctgggtgggtctgaagccctcctgttgggcttcatgtcctat
gacaggtacatagccatctgtcagcccgtgcactaccctgtgctcatgagcaggaagatc
tgctgctctattgtcaccagtacatggagtagtagctccatcactgcattaatgcacata
atctatttatttcaacttccattatgtggatctaggattaaccactttttctgtgaggtt
ccatctctcctgccactggtgtgtgaagacacgtcccaatatgagcatgcagtcctcatg
agtggccttgtcattctgttgttacccttcctggccatcctagcttcctatgctcgggtg
ttggttgtattccagatgggttcagggaagggacagagtagagcagtgtccacctgctcc
tcccacttgactgtggccagcctgttctacatcactactctctccacctacacccaacca
cacactttgcattctcctgggagggacaaagtggtagctgtgatctactcaattgtcacc
catgttttgaacccgttcatctacagcctgaggaacaaggaggtcatgtgggccctaaaa
agacaaatgggatga

DBGET integrated database retrieval system