KEGG   Rattus norvegicus (rat): 405064
Entry
405064            CDS       T01003                                 

Gene name
Olr1406
Definition
(RefSeq) olfactory receptor 1406
  KO
K04257  olfactory receptor
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    405064 (Olr1406)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rno04030]
    405064 (Olr1406)
G protein-coupled receptors [BR:rno04030]
 Others
  Chemoreception
   Olfactory
    405064 (Olr1406)
SSDB
Motif
Pfam: 7tm_4 7tm_1 7TM_GPCR_Srsx
Other DBs
NCBI-GeneID: 405064
NCBI-ProteinID: NP_001000786
RGD: 1333596
Ensembl: ENSRNOG00000029930
UniProt: D3ZEC4
Position
10q22
AA seq 303 aa
MDGPNQTATEFLLLGFSEQEEVVFGMFLGMYMVTISGNLLIILVISCDPRLHTPMYFFLA
NLSSVDICFSSVTVPKALVNHMLGSKTISYTECMAQMYFLFIFGNMDGFLLSVMAYDRYV
AICHPLHYTMMMRPRLCVLLVAISWVITNLHALLHILLMVQLTFCSYNAVRHFFCDPYLI
LKLSCSDTFINDVAAFTEGPLIFLTPFICIVVSYAYIYAKVLKIPSAHGIKKALSTCGSH
LTVVCLFYGAILGVYMHPSSSYSLQDAVASVIFTVVTPMVNPFIYSMRNRDIKGALRKII
LTS
NT seq 912 nt   +upstreamnt  +downstreamnt
atggatggtcccaatcagacagctacagaatttctcctcctgggattctcagagcaggaa
gaggttgtctttggaatgttcttgggcatgtacatggtcaccatctctgggaaccttctc
atcatcctggtcatcagctgtgaccctcgactccacacacccatgtacttcttcttggcc
aacctctccagtgttgacatctgcttttcctcagtcactgtccccaaggctctggtgaac
cacatgttgggaagcaagaccatctcttacacagagtgtatggcccagatgtacttcttg
ttcatatttggcaacatggatggcttccttctgagtgtgatggcctatgaccgctatgtg
gccatctgtcacccactccactacaccatgatgatgaggcccagactctgtgtcctcctg
gtggccatatcatgggtcatcacaaacctgcatgctctcttgcacattctcctcatggtt
caactcaccttctgttcctacaatgcagtgcggcacttcttctgtgacccctatcttatc
ctgaagctctcttgttctgataccttcattaatgatgttgcagccttcactgagggcccc
ttgatattcctgacaccgtttatatgcattgtcgtttcttatgcctacatctacgctaag
gtcttgaagattccctctgcccatggaataaaaaaagctctatccacatgtgggtctcac
ctcactgtggtctgcctcttctatggggcaatcctgggagtttatatgcatccttcttcc
tcatactcactccaagatgcagtggcctctgtcatcttcactgtggtgacacccatggtc
aaccctttcatctacagcatgaggaatcgtgacatcaaaggagccctaagaaagataatt
ctcacatcctag

DBGET integrated database retrieval system