KEGG   Rattus norvegicus (rat): 405066
Entry
405066            CDS       T01003                                 

Gene name
Olr1388
Definition
(RefSeq) olfactory receptor 1388
  KO
K04257  olfactory receptor
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    405066 (Olr1388)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rno04030]
    405066 (Olr1388)
G protein-coupled receptors [BR:rno04030]
 Others
  Chemoreception
   Olfactory
    405066 (Olr1388)
SSDB
Motif
Pfam: 7tm_4 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srbc
Other DBs
NCBI-GeneID: 405066
NCBI-ProteinID: NP_001000788
RGD: 1333100
Ensembl: ENSRNOG00000046425
UniProt: D4A130
Position
10q21
AA seq 311 aa
MGSFNASLDKGFMLVGFSDWPELELIFFIYILIFYSVTLFGNTAIIALSRMDLRLHTPMY
FFLSHLSFLDLCYTTSTVPQLLINLHGLDRTISYGGCVAQLFISLALGSTESVLLVVMAF
DRYAAVCRPLHYTTMMHPVLCQALAIASWVGGFLNSLIQTGLMMAMPLCGHRLNHFFCEM
PVFLKLACEDTEGTEAKMFVARVVIVAVPAMLILGSYAQIARAVLRVKSVAARRKAAETC
GSHLLVVSLFYGSATYTYLQPKDSYSESKGKFFALFYTIITPMLNPLIYTLRNKDVKGAL
WKVLGRAAATV
NT seq 936 nt   +upstreamnt  +downstreamnt
atgggaagcttcaacgccagtttggataaaggcttcatgttggtgggcttctcagactgg
cctgaactagaactcatcttctttatttatattttgattttctactctgtaactctcttt
ggcaacactgccatcatcgctctctcccgaatggaccttcggttacacactcccatgtac
ttcttcctctcacacctctccttcttggacctttgctataccaccagcaccgtgccccag
ctcctgatcaacctccatggacttgacagaaccatcagctatggagggtgtgtggcccag
ctgtttatatctcttgctctgggatccacagagagtgtgctcctggtggtgatggctttt
gaccgctatgctgctgtgtgtcgtccactgcactacacgaccatgatgcaccctgttctc
tgccaggcattggctattgcttcctgggtaggaggcttcttgaactctctgattcaaaca
ggactcatgatggccatgcctctctgtggacaccgactgaatcacttcttctgtgagatg
cctgtgttcctcaagttggcctgtgaagacaccgaaggaacagaggccaagatgtttgtg
gcgagagtggtgattgtcgcagtgccggccatgctcattctaggctcctatgctcagatt
gctagggcagtgttgagggtcaagtcagtggctgcacgcagaaaggctgctgagacttgt
ggttcccacctcctggtggtttctctcttctatggctcggccacctacacatacttacaa
cccaaggacagctattctgagagcaaggggaaattttttgcccttttttataccatcatc
acccccatgctcaaccctctgatctataccctgaggaacaaggatgtgaagggggctctg
tggaaggtgctagggagagctgcagccacggtgtag

DBGET integrated database retrieval system