KEGG   Rattus norvegicus (rat): 405082
Entry
405082            CDS       T01003                                 

Gene name
Olr1288
Definition
(RefSeq) olfactory receptor 1288
  KO
K04257  olfactory receptor
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    405082 (Olr1288)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rno04030]
    405082 (Olr1288)
G protein-coupled receptors [BR:rno04030]
 Others
  Chemoreception
   Olfactory
    405082 (Olr1288)
SSDB
Motif
Pfam: 7tm_4 7tm_1 SH Glycoprotein_G
Other DBs
NCBI-GeneID: 405082
NCBI-ProteinID: NP_001000798
RGD: 1333004
Ensembl: ENSRNOG00000057310
UniProt: A0A0G2K2X4
Position
15p12
AA seq 314 aa
MEDIAAGNHCTVTEFFLAGLSEKPELQLPLFLFFTGIYLITVAGNLGMITLIGLSSHLHT
PMYYFLSSLSFIDFCQSTVVVPKMLVSFLTKKKLISYPACMVQLYFFLTFGIAECYTLAA
MAYDRYVAICNPLLYNVTMTDEKHCSLISGVYIFAVFCASVKTGFMGRIQFCQFDVIDHY
FCDLLPLLKLASSSTYINQALILFFGTLNLFIPVMTIITSYVFIIATILYIHSSEGKFKA
FRTCSSHISAVGIFYVSGAFTYLHPSSLNSMNQVKLSSVFYTTIVPMLNPLIYSLRNKDV
SIALKKIFERKKFM
NT seq 945 nt   +upstreamnt  +downstreamnt
atggaggacatagcagcaggaaaccactgcacagtgactgagttcttcttggcggggctc
tcagagaagccagaactccagcttccccttttcctcttcttcacaggaatctatctgatc
accgtagcagggaacctgggcatgatcacactgattgggctcagttcccatctgcacaca
cccatgtactattttctcagcagtctgtccttcattgacttctgtcagtccacagttgtt
gtacctaaaatgctggtgagctttttgacaaagaagaaactcatctcctaccctgcctgc
atggttcagctctacttcttcctaacttttggtattgcagagtgctacacgttagctgca
atggcttatgaccgctatgttgccatctgtaacccattgctttacaatgtaaccatgacc
gatgagaagcactgttctcttatttcaggggtatatatttttgctgttttttgtgcatct
gtaaagactggctttatgggtaggattcagttctgccaatttgatgtgattgaccactat
ttctgtgatcttcttcccctcttgaaacttgcatcctctagtacctatatcaatcaagca
ttgattctattttttggtacactaaacctctttatcccagtgatgaccatcattacttct
tatgtcttcattattgccaccatcctctacattcactccagcgaggggaagttcaaagct
tttagaacttgcagttctcacatctctgctgttggtatattctatgtttctggtgcattc
acgtacttacatccctcttcattgaattctatgaaccaagtgaaattgtcatctgtgttt
tatactactattgtaccgatgctgaaccccttgatctatagcctgaggaataaggatgtc
agtattgcgttgaagaaaatatttgaaagaaaaaaattcatgtaa

DBGET integrated database retrieval system