KEGG   Rattus norvegicus (rat): 405096Help
Entry
405096            CDS       T01003                                 

Gene name
Olr1244
Definition
(RefSeq) olfactory receptor 1244
  KO
K04257  olfactory receptor
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    405096 (Olr1244)
G protein-coupled receptors [BR:rno04030]
 Others
  Chemoreception
   Olfactory
    405096 (Olr1244)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_4 7tm_1
Motif
Other DBs
NCBI-GeneID: 405096
NCBI-ProteinID: NP_001000810
RGD: 1333908
Ensembl: ENSRNOG00000061646
UniProt: A0A0G2K7R6
Position
4q11
AA seq 310 aa AA seqDB search
MGLENGSLVTEFILQGLTNDPDLQLPLFLLFLLIYTATVLGNLALITLIALNSHLHTPMY
FFLLNLSFIDLCYSSVITPKMLMNFFVKKNFISYVGCMTQLYFFCFFAVSECCVLSSMAY
DRYVAICNPLLYNISMSPKVCSYLMFGSYIMGFSGAMIHTGWILRLTFCDRNIINHYFCD
LLPLLQLSCTNTYANEVEIIVVGGIDIIVPSVIIFTSYAFILSNIFQMRSTEGRSKAFST
CSSHIIAVSLFFGSGAFMYLQPSSPESMDQGKRSSIFYTILVPMMNPLIYSLRNKDVKVA
LKKTFNRRKL
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgggtttggaaaatggttctttagtgactgaattcattctgcagggattgacaaatgat
cctgatctccagttacccctgttcctactctttctgctaatatacacagcaacagtactt
gggaacttggctttgatcactttaattgcactgaattctcaccttcacactcccatgtat
tttttccttttaaacttgtccttcattgacctctgctattcctctgtgattacacctaaa
atgctgatgaacttcttcgtaaagaagaactttatctcctatgtaggatgtatgacccaa
ctctatttcttttgtttctttgctgttagtgaatgctgtgttctgtcatcaatggcctat
gatcgttatgtggccatatgcaatccactcttgtataacatttctatgtctccaaaggtg
tgttcctatcttatgtttggttcatatataatgggattttctggtgccatgatccacact
ggatggattcttagactgaccttctgtgataggaacattatcaaccactatttctgtgac
ctactcccgttgttgcagctctcctgtaccaacacctatgccaatgaagttgagattatt
gttgtaggtgggatcgatatcatcgtgcccagcgtcatcatttttacctcttatgccttc
attctctctaacatctttcaaatgagatccactgagggcagatccaaagcctttagtacc
tgcagctcccacataattgctgtttctttattctttggttcaggtgcatttatgtatctt
caaccctcttcacctgagtctatggatcagggaaaaaggtcttctattttttataccata
ttagtgcctatgatgaaccctttaatctatagtttgagaaacaaagatgtcaaagttgcc
ctgaaaaaaacatttaacaggaggaagttgtga

DBGET integrated database retrieval system