KEGG   Rattus norvegicus (rat): 405105Help
Entry
405105            CDS       T01003                                 

Gene name
Olr1202
Definition
(RefSeq) olfactory receptor 1202
  KO
K04257  olfactory receptor
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    405105 (Olr1202)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rno04030]
    405105 (Olr1202)
G protein-coupled receptors [BR:rno04030]
 Others
  Chemoreception
   Olfactory
    405105 (Olr1202)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_4 7tm_1
Motif
Other DBs
NCBI-GeneID: 405105
NCBI-ProteinID: NP_001000817
RGD: 1333142
Ensembl: ENSRNOG00000051309
Vega: OTTRNOG00000001063
UniProt: D3ZNU9
Position
8q21
AA seq 309 aa AA seqDB search
MAPRNSSSVIEFILVGFSDQPALQLPLFFFFLGIYMLTVVGNLGLITLIGLNSGLHTPMY
FFLFNLSFIDFCYSCVFTPKMLTDFVSENIISYVGCMTQLFFFCFFVNSECYVLVSMAYD
RYVAICNPLLYTVTMSPQVCALLMFGSYVIGFAGAMAHTGSMLTLTFCESNRIHHYLCEV
LPLLQLSCTSTYANELVFFIVVGLVITASSVSIFISYALIISNILKIPSAEGRSKAFGTC
GSHVVAVALFFGSGAFTYLTTSFPGSMKEGRFASVFYTNVVPMLNPLIYSLRNKDVKLAL
NKTLQRVLF
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atggctccaagaaatagctcctctgtgattgaatttatccttgtgggattttcagaccaa
ccagctctccagctgcctctcttcttcttcttcttaggcatctatatgctcactgtcgta
ggcaatttgggactgatcaccttaattgggttgaattctggtcttcatactccaatgtac
tttttcctcttcaacttgtcctttatagatttttgttactcctgtgtgttcacccccaaa
atgttgactgattttgtctcagaaaatattatctcttacgtgggatgcatgactcaactg
tttttcttctgtttctttgtcaattctgagtgctatgtgctggtttcaatggcctatgat
cgctatgtggccatctgcaaccctctgctctacacggtcaccatgtctcctcaggtctgc
gctctgctgatgtttggttcatatgtgataggatttgctggagccatggcacacactgga
agcatgctgacacttactttctgtgagtccaacaggatccaccactatctctgtgaagtt
ctccccctcctgcagctctcctgcaccagcacctatgccaacgagcttgtgttttttatt
gttgttgggctggtcatcacagcatccagtgtcagcatctttatctcttatgcgttgata
atctccaacattcttaagattccttccgcggagggcagatccaaagcctttggcacatgt
ggttcccatgtagttgcagttgctctgttttttgggtcaggggcgttcacctatttaacc
acgtctttccctgggtcaatgaaagagggaaggtttgcttcagtattttataccaatgtg
gttcccatgcttaacccactgatctatagtttgagaaataaagatgtcaaacttgccctt
aataaaaccttgcagagagtgctcttctga

DBGET integrated database retrieval system