KEGG   Rattus norvegicus (rat): 405110Help
Entry
405110            CDS       T01003                                 

Gene name
Olr868
Definition
(RefSeq) olfactory receptor 868
  KO
K04257  olfactory receptor
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    405110 (Olr868)
G protein-coupled receptors [BR:rno04030]
 Others
  Chemoreception
   Olfactory
    405110 (Olr868)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_4 7tm_1 7TM_GPCR_Srsx Glycoprotein_G
Motif
Other DBs
NCBI-GeneID: 405110
NCBI-ProteinID: NP_001000821
RGD: 1333113
Ensembl: ENSRNOG00000047897
UniProt: D3ZSH9
Position
5q36
AA seq 315 aa AA seqDB search
MWVISGQNQSWVSEFILIGFSRDPVTNNILFFVFLLIYLSSVLGNGLIIMLVCLDTQLHT
PMYFFLCTLSLLDMSYVTTTVPQMLVHLLAHSKTISFAGCGLQMYVFAALGITECTFFVV
MAYDRYVAICYPLRYTVILSWGLCIRMAAGSWICGFLSSLLHTFFTMSLPYCGPNKVNHY
FCEGPSVRSLACMDTHLIDMVDFVLSVFVVVIPISLIVASYIHIAMAILKIKSTQGRCKA
FSTCASHLTVVTFFYAPAIYIYMRPNSSYSPERDKQISLFYNVFTALLNPVVYSLRNKDI
KRAFLKVMGHVRVDW
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atgtgggtgatttcagggcagaaccaaagttgggtttctgaatttattctaattggcttc
tccagagaccctgtgaccaacaacatcctcttctttgtcttccttctcatctacctgagc
tcagtcctgggcaacgggctcatcatcatgctggtctgcctggacacacagctgcacacg
cccatgtacttcttcctctgtaccctctccctgttggatatgagctatgtcaccaccact
gtgccccagatgttggtgcatcttcttgctcactctaagaccatctccttcgctggctgc
ggtctgcagatgtatgtgtttgcggccctgggtatcactgaatgtaccttctttgttgtc
atggcttatgaccggtatgtggccatttgctatccactgcgctatactgtcatcctcagc
tggggtctgtgcatacggatggcagcagggtcgtggatctgtggtttcctttcctccttg
ctgcatactttcttcaccatgagtctaccctattgtgggcccaacaaagtcaaccactac
ttctgtgaaggtccttcagtgcggagcctggcttgcatggatacccacctcattgatatg
gtggactttgttttgagtgtctttgtggttgttattccaatctccctcattgtggcctcc
tacattcatattgccatggcaattctgaagatcaagtccacccagggccgctgcaaggct
ttctctacctgtgcctcccacctgactgtggtcacattcttctatgctccagccatttac
atctacatgaggcccaactccagctactctcctgagcgagacaagcagatctcactcttt
tacaatgtcttcacagccttgctcaatcctgtggtctacagtctgagaaataaagatatt
aagagagcatttctcaaggtgatgggacatgttagggtggactggtga

DBGET integrated database retrieval system