KEGG   Rattus norvegicus (rat): 405112Help
Entry
405112            CDS       T01003                                 

Gene name
Olr427
Definition
(RefSeq) olfactory receptor 427
  KO
K04257  olfactory receptor
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    405112 (Olr427)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rno04030]
    405112 (Olr427)
G protein-coupled receptors [BR:rno04030]
 Others
  Chemoreception
   Olfactory
    405112 (Olr427)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_4 7tm_1 7TM_GPCR_Srsx SLC3A2_N
Motif
Other DBs
NCBI-GeneID: 405112
NCBI-ProteinID: NP_001000823
RGD: 1332825
Ensembl: ENSRNOG00000031763
UniProt: D3ZIV0
Position
3q11
AA seq 307 aa AA seqDB search
MNSSSTSDFILLGLSSDPWMQKPLFVIFIVMYLVTVVGNVLIILVIRSDTKLHTPMYFFL
SNLSFMDICFTTVIVPKMLVNVLSKTKTISYVGCLVQMYFFIALANTDSYLLASMAIDRL
VAICNPLHYDVVMRPQHCLLMLLGSCTISHLHALFRVLLMSRLSFCASHVIKHFFCDTQP
VLKLSCSDTSSNQIVVMTETLAVIVTPFLCILFSYLRIIVTVLRIPSAAGKWKAFSTCGS
HLTVVSLFYGSVIYVYFRPLSMYSVVKDRVATIMYTVVTPMMNPFIYSLRNKDMKRGLRK
LRDRFHS
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgaacagtagcagtacctcggacttcatcttgctgggtctctcttccgatccctggatg
caaaaacccctttttgtcatcttcattgtcatgtacctggtcaccgtggtggggaatgtg
cttatcatcctggttatccgctctgacaccaagctccatactcccatgtactttttcctc
agcaacttgtcattcatggatatctgcttcacaacagtcattgtgcccaagatgctagtg
aatgtgctctcaaagacaaaaactatctcctacgtgggatgcctagtacagatgtacttc
tttatagcattagcaaacactgatagctacctgctggcttccatggccattgaccgatta
gtggccatctgcaaccctttacattatgatgtggtaatgaggccacaacactgcctcctc
atgcttctgggttcttgcaccatctcccatctacatgccttgttccgtgtcctccttatg
tctcgactctcattctgtgcctcccatgtcattaagcactttttctgtgacactcagcct
gtgctaaagctgtcctgctctgacacatcttccaatcagattgtagtcatgactgagacc
ctggctgtcattgtgacccccttcctatgtatcctcttttcctaccttcgaatcattgtc
actgtgctcaggatcccctctgcagctggaaagtggaaagccttctctacctgtggctct
cacctcactgtagtgtctctgttctatgggagtgtcatctatgtctactttaggcccctg
tccatgtactcagtggtgaaggaccgggtagccaccattatgtacacagtagtaacacct
atgatgaatcctttcatctatagcctgaggaacaaagatatgaagagaggtttgaggaag
ttaagggacaggtttcactcatag

DBGET integrated database retrieval system