KEGG   Rattus norvegicus (rat): 405147Help
Entry
405147            CDS       T01003                                 

Gene name
Olr386
Definition
(RefSeq) olfactory receptor 386
  KO
K04257  olfactory receptor
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    405147 (Olr386)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rno04030]
    405147 (Olr386)
G protein-coupled receptors [BR:rno04030]
 Others
  Chemoreception
   Olfactory
    405147 (Olr386)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_4 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx 7TM_GPCR_Srbc
Motif
Other DBs
NCBI-GeneID: 405147
NCBI-ProteinID: NP_001000856
RGD: 1333767
Ensembl: ENSRNOG00000056884
UniProt: D4A2B3
Position
1q12
AA seq 324 aa AA seqDB search
MESPTPIPTANRTSVLEFLLLGVTEKRGLQLLLFGVLLVTYTLTLLGNLLIIALTLADRR
LHTPMYFFLRHFSLLEVGFTSTVSPQMLAHLLAARGAISRHRCFAQMILYFTLGAVETLL
LAVMSTDRFLAICWPLRYPALMTPRVCSALVLACWGASLLALPGLFAWMLSLPFCGPRVL
NHFFCDSSPLLELVCADTRLLQLVAFLVAVCTLLTATLITTLSYGCIISTILRLPTPGGR
SKAFSTCSSHILVVSLTYGSCIIMYLNPTQTGRLDLNKGIAFFNTTVSPLLNPFIYCLRN
QLVHRVCRDLLLRGRELSSKIFRA
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atggagtccccgacgcccatccccacagccaaccgcacctccgtgctagagttcctgctt
ctgggggtcacagaaaagcgagggctccagctcctcctcttcggggtcctcctggtcacc
tacacgctgaccttgctggggaatcttctcatcatcgctctcaccttggcggaccgccgc
ctgcacaccccgatgtacttcttcctgcgccacttctcgctgctggaggtgggtttcacc
tccaccgtgtccccacagatgctggcacacctgctggcagcgcgcggagccatctcccgc
caccgctgcttcgcgcagatgatactctacttcaccctgggcgcagtggagaccctgctg
ctggcagtgatgtccactgaccgctttctggccatctgctggcctctgcgctacccagca
ctcatgactccccgcgtgtgctctgccctggtgctggcctgctggggagccagcctcctg
gccctgcctgggctgtttgcctggatgttgtctcttcctttctgtggcccacgtgtcctc
aaccacttcttctgcgacagctcccctttgctggagctggtgtgcgcagacaccaggctt
ctgcagctggtggccttcctggtggctgtctgcaccctgctcactgccacgttgatcaca
accttatcctatggctgcatcatcagcaccatcctgcgcctgcctacacctgggggtcgc
agcaaggccttctccacttgttcttcccacatcttggtggtgtctctcacctatgggagc
tgcatcatcatgtatctcaaccccacgcagacaggaaggctggacctcaacaaaggaata
gctttcttcaacaccacggtgtctcccctgctgaaccccttcatctactgcctcaggaac
caactggttcacagagtgtgcagggatttgctgctcaggggaagggagctttcttccaag
atattcagagcataa

DBGET integrated database retrieval system