KEGG   Rattus norvegicus (rat): 405152Help
Entry
405152            CDS       T01003                                 

Gene name
Olr1192
Definition
(RefSeq) olfactory receptor 1192
  KO
K04257  olfactory receptor
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    405152 (Olr1192)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rno04030]
    405152 (Olr1192)
G protein-coupled receptors [BR:rno04030]
 Others
  Chemoreception
   Olfactory
    405152 (Olr1192)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_4 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx
Motif
Other DBs
NCBI-GeneID: 405152
NCBI-ProteinID: NP_001000859
RGD: 1333078
Ensembl: ENSRNOG00000033025
UniProt: D3ZL48
Position
8q13
AA seq 320 aa AA seqDB search
MKPGNQTSTLEFLLLGFCQDPEHQPMLFGLFLFIFVVAVLGNLLIILAVSVDSHLHIPMY
FFLCNLSFSDICFISTTIPKMLVNIQTQSKSITYAECITQMYFFMVFGGMDTFLLTVMAY
DRFVAICHPLHYPVIMNPHLSGLLVLVSWFISFSYSLIQSLLMLRLSFCTNQIIKHFYCE
HATALTIACSDTLINHILLYIVTCVLGFVPFSGIIYSYSKIVSSILKIPSTDGKYKAFST
CGSHLLVVSLFYGTGLGVYLSSDATSSSWKGMVASVMYTVITPMLNPFIYSLRNKDIKKA
LQTLGTNIFLSDKFSWCLDF
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgaaaccaggaaaccaaacaagtactttagaatttttacttctggggttttgccaagat
ccagagcatcaacccatgctatttggactgtttctgttcatctttgtggtcgctgtgctt
gggaatctgctcatcattctggctgtcagcgttgactctcacctacatattcccatgtac
ttcttcctatgtaatctatccttttctgacatttgtttcatctctacaacgatccctaag
atgttggtgaacatccaaacacagagcaagtccatcacctatgcagaatgcatcacccag
atgtattttttcatggtctttggaggcatggacacatttctcctcaccgtgatggcctat
gaccgatttgtggccatctgtcacccccttcactatccagtcattatgaatcctcatcta
agtggcctgctagttcttgtgtcctggttcattagcttctcatattctctgatccagagt
ctattgatgctgcggctgtccttctgtaccaaccaaataatcaaacacttttactgtgaa
catgccacagccctcactatagcctgctcagacacactaatcaatcatattcttctttat
atagtgacatgtgtccttggctttgttcctttctcagggatcatttactcctactctaaa
attgtttcctctattttgaaaattccatcaacagatggaaaatataaagcattttctacc
tgtgggtctcacctattagtggtttctttattttatgggacagggcttggtgtatatctt
agttctgatgcaacttcctcttcatggaaaggcatggtggcctcagtaatgtatacagtc
atcacccccatgctgaacccttttatctacagcttgagaaacaaagacattaagaaagcc
ttacaaacacttgggacaaacatttttttaagtgataagttcagctggtgtttagatttc
tga

DBGET integrated database retrieval system