KEGG   Rattus norvegicus (rat): 405210
Entry
405210            CDS       T01003                                 

Gene name
Olr830
Definition
(RefSeq) olfactory receptor 830
  KO
K04257  olfactory receptor
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    405210 (Olr830)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rno04030]
    405210 (Olr830)
G protein-coupled receptors [BR:rno04030]
 Others
  Chemoreception
   Olfactory
    405210 (Olr830)
SSDB
Motif
Pfam: 7tm_4 7tm_1 7TM_GPCR_Srx
Other DBs
NCBI-GeneID: 405210
NCBI-ProteinID: NP_001000900
RGD: 1334034
Ensembl: ENSRNOG00000013367
UniProt: D4ABI3
Position
4q42
AA seq 320 aa
MAKEAEVRMEAWNETTVLAFVLEGFLVAPRLGKALFLVHLLVYLASVTGNTLIIAITWAD
PRLQTPMYFFLRSFSICECCFISTVIPKLLSIFLFGDRTIHFAPCIIQAFSFLFLGSTIF
FHMAVMSLDRYLAICKPLHYPAIMNPRVCFLLVFLSYVLSFLLVTGVILKLSWLSFCGSN
VIPHFFCDLGSLIHLSCSDTKSLEKMAFGVALVILFTSVLAAIFAYSNILISIMRLPSAK
ERQKAFSTCSSHLMVLSLMYGSCVFIYVKPKQTSRFESNREAALVNTVVTPLLNPVIYTL
RNKQVHQALRDALSRVNLQK
NT seq 963 nt   +upstreamnt  +downstreamnt
atggcaaaagaagcggaggtaaggatggaggcgtggaatgagacaacagtcctggcgttt
gtgctggagggcttccttgtggctccgcgcctgggcaaggccctcttcctcgtgcacctg
ctggtgtatctggcctcagtcacaggaaacacactcataatcgccatcacttgggccgat
cctcgcctgcagaccccgatgtacttcttcctcagaagtttctccatctgtgagtgctgt
ttcatctccacggttatcccgaagctcctgtccatctttctttttggagacagaacgatt
catttcgctccctgtatcatccaagcattttcttttttatttcttgggtcaacaattttc
ttccacatggctgtgatgtccttggaccgctatctggccatttgcaaacctctgcactac
ccagccatcatgaaccccagggtctgtttccttctggttttcctcagctacgtgctttcc
ttcctcctggtaaccggtgtgattctcaagctttcctggttgtctttctgtggctctaat
gtcattccccatttcttctgtgaccttggctccttaattcatctctcctgttcagacacc
aaatctcttgaaaaaatggccttcggcgtcgctttggttatccttttcacgtctgtcctt
gcagcaatatttgcatacagcaacatactaatctcaatcatgcgcctcccatcggccaag
gagaggcagaaagctttctccacctgctcatcccacctcatggtcctctctctgatgtac
ggcagctgtgtatttatatatgtgaaaccaaagcaaaccagcaggtttgaatccaacaga
gaggctgctctcgtaaacacggtagtgacaccgcttctgaatcctgtcatctacaccctg
cgcaacaagcaggtccaccaggctctgagggatgcactgtctagggtgaacttacagaaa
tag

DBGET integrated database retrieval system