KEGG   Rattus norvegicus (rat): 405214
Entry
405214            CDS       T01003                                 

Gene name
Olr825, SCR_G-14, SCR_G-15
Definition
(RefSeq) olfactory receptor 825
  KO
K04257  olfactory receptor
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    405214 (Olr825)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rno04030]
    405214 (Olr825)
G protein-coupled receptors [BR:rno04030]
 Others
  Chemoreception
   Olfactory
    405214 (Olr825)
SSDB
Motif
Pfam: 7tm_4 7tm_1 7TM_GPCR_Srsx
Other DBs
NCBI-GeneID: 405214
NCBI-ProteinID: NP_001000904
RGD: 1333814
Ensembl: ENSRNOG00000048952
UniProt: F1MAA6
Position
4q42
AA seq 327 aa
MEWLMTEETRNGTLVLEFILEGYPVAEHLKILFFLLHLLAYLASLMGNMLIITITCVDHR
LQTPMYFFLSTFSFVECCFITTAIPQLLTIILSGRQKIPFGVCFSQAFVYLVVGATGFFL
LAALSLDRFLAICKPLHYPTIMSPRMCFLLVTVSLVLGFLFMASPVVMLSQSFYCGPNII
PHFFCDFGPLANLSCSETRSIEMLFFTLAVIVLFASLLIAIFAYSNIVVTIVRLPSARER
QRAFSTCSSHLIVLSLMYGSCAFIYLKPKQRSRVDTNREAALVNTVVTPLLNPVIYTLRN
KQVHQALRDALSKVQLHRYQRMKAPFL
NT seq 984 nt   +upstreamnt  +downstreamnt
atggaatggctaatgacagaggagacaaggaatgggactttggtcctggagttcatcctt
gaggggtaccctgtggccgagcacctgaagatcctcttcttcctactgcacttgctggcc
tacttggcctccctcatgggcaacatgctcataattaccatcacctgtgtggaccaccga
ctgcagacgcccatgtacttctttctcagcaccttctcttttgtggagtgttgttttata
actactgctatcccccagctcctcaccatcattctgtcagggaggcaaaagattcccttt
ggggtctgcttctcacaggccttcgtctatcttgtcgtgggggcaacaggttttttcctt
ttggctgcgttatccctggaccgctttctggccatctgcaaacctctacattatccaacc
atcatgagcccaaggatgtgcttccttctcgttactgtctctttagttttgggattcctc
ttcatggccagtccagttgtgatgctttcccagtcattttactgtggcccaaacattatt
cctcactttttctgtgattttggaccactggcaaatctctcctgttcagaaaccaggtct
attgagatgctgttttttacccttgctgtaattgtgctttttgcttcccttctgatcgcc
atctttgcatacagcaatatagtagtcaccatagtgcgtcttccttcagccagggagcga
cagagagctttttccacctgctcctctcatctcattgtcctctctctaatgtatggcagc
tgtgcatttatatacctgaagccaaagcagagaagcagagtggacaccaacagagaggct
gctcttgtgaacacagtagtgacaccccttctgaaccctgtcatctacaccctgcgcaac
aagcaggtccaccaggctctcagggatgctctgtccaaggttcaattgcacagatatcag
aggatgaaggctcctttcctttga

DBGET integrated database retrieval system