KEGG   Rattus norvegicus (rat): 405215Help
Entry
405215            CDS       T01003                                 

Gene name
Olr824
Definition
(RefSeq) olfactory receptor 824
  KO
K04257  olfactory receptor
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    405215 (Olr824)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rno04030]
    405215 (Olr824)
G protein-coupled receptors [BR:rno04030]
 Others
  Chemoreception
   Olfactory
    405215 (Olr824)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_4 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx
Motif
Other DBs
NCBI-GeneID: 405215
NCBI-ProteinID: NP_001000905
RGD: 1333048
Ensembl: ENSRNOG00000047994
UniProt: D3ZVG9
Position
4q42
AA seq 327 aa AA seqDB search
MEWVMAEETRNGTLVQEFILEGFPVAEHLRILFFLLHLLAYLASLMGNMLIITITCVDHR
LQTPMYFFLSSFSFVECCFITTAIPQLLTILLSGRQKISFGACFSQAFVYLVLGATVFFL
MAVLSLDRFLAICKPLHYPTIMSPRMCFLLVTVCLFLGFLFMASPVVMLSQSFYCGPNII
PHFFCDFGPLANLSCSETRSIEMLFFTLAIIVLFASFLIAIFAYSNIVVTIVRLPSARER
QRAFSTCSSHLIVLSLMYGSCAFIYLKPKQRSRVDSNREAALVNTVVTPLLNPVIYTLRN
KQVHQALRDALSRLQLHRYQRRKAPFL
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atggaatgggtgatggctgaggagacaaggaatgggactttggtccaggagttcatcctt
gaggggttccctgtagctgagcacctgaggatcctcttcttcctactgcacttgctggcc
tacttggcctccctcatgggcaacatgctcataattaccatcacctgtgtggaccaccga
ctgcagacgcccatgtacttctttctcagctcgttctcctttgtggagtgttgttttata
actactgctatcccccagctcctcaccatccttctgtcagggaggcaaaaaatttccttt
ggggcctgcttctcacaggcctttgtctatcttgtccttggggcaacagtttttttcctt
atggctgtgttatccctggaccgctttctggccatctgcaaacctctacattatccaaca
atcatgagcccaaggatgtgcttccttctcgttactgtctgtttatttttgggcttcctc
ttcatggccagtccagttgtgatgctttcccagtcattttactgtggcccaaacattatt
cctcactttttctgtgattttggaccactggcaaatctctcctgttcagaaaccaggtct
attgagatgctgttttttacccttgctataattgtgctttttgcttcctttcttatagcc
atctttgcatacagcaatatagtagtcaccatagtgagactcccttcagccagggagcga
cagagagctttttccacctgttcctctcatctcattgtcctctctctaatgtatggcagc
tgtgcatttatatacctgaagccaaagcagagaagcagagtggacagcaacagagaggct
gctcttgtgaacacagtagtgacaccccttctgaatcctgtcatctacaccctgcgcaac
aagcaggtccaccaggctctcagggatgctctgtccaggcttcaattacacagatatcag
aggaggaaggctcctttcctttga

DBGET integrated database retrieval system