KEGG   Rattus norvegicus (rat): 405216Help
Entry
405216            CDS       T01003                                 

Gene name
Olr1104
Definition
(RefSeq) olfactory receptor 1104
  KO
K04257  olfactory receptor
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    405216 (Olr1104)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rno04030]
    405216 (Olr1104)
G protein-coupled receptors [BR:rno04030]
 Others
  Chemoreception
   Olfactory
    405216 (Olr1104)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_4 7tm_1 7TM_GPCR_Srsx
Motif
Other DBs
NCBI-GeneID: 405216
NCBI-ProteinID: NP_001000906
RGD: 1333884
Ensembl: ENSRNOG00000031284
UniProt: D4AE45
Position
7q36
AA seq 319 aa AA seqDB search
MGNVSAVSEFILLGLSADAQVQAVLFMVFLVIYVLTLTGNSMILLAISTDARLRSPMYFF
LGHLSFLDLLYSSVSMPKMLENLVSERKTISVKGCLAQAFFVFAIGGTEALLLAVMAYDR
YAAICHPLLYHQMMSNWFCQGLVWGSWSLAILNSLINTLLAVNLDFCHHGTVHNYNCELP
SLFPLSCSDVSTNVTALLWTFLVHASGTFLLMVCSYGCVFSTILNMSSTRGRSKAFSTCS
SHLTVVTLYFGSAFLRYVLPTSGSPVETFFSLQYSVITPLLNPFIYSLKNKEVKTAMRKL
LGRCCQHFGYVGRRRRVKS
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atggggaacgtgagtgccgtctctgagttcatcctccttggtctgtctgctgatgctcag
gtccaggctgtactctttatggttttccttgtgatctacgtcctgaccctgacggggaac
tctatgattctgctagcgatatcgactgatgctcgcctccgttctcctatgtactttttt
ctgggccacctctccttcctggaccttttgtattcgtcagtctccatgcccaagatgctg
gagaatctagtgtctgagaggaaaacaatctccgtgaagggttgtctggcccaggccttc
ttcgtgtttgccattggaggcaccgaggctttgctccttgcggttatggcatatgaccgc
tacgcggccatttgccatcctctcctctaccaccagatgatgagcaactggttctgtcag
gggctcgtgtgggggtcctggagcctggccatactgaactcactcattaataccctctta
gctgtgaatttggacttttgtcaccatggaaccgtacacaactacaactgtgagcttcct
tccctcttccctctctcctgctctgatgtctccactaacgtcactgccttgctctggact
tttctcgtacacgcctctggaaccttccttctcatggtatgttcctacggctgcgttttc
tccaccatcctgaacatgagctccaccaggggcagaagcaaggctttctccacctgctcc
tcccacctcaccgtagtgaccttgtactttggttccgccttcctgcgctacgtcctgccg
acctcggggtctcccgtggaaacgttcttctctctgcagtacagcgtcatcactcccttg
ctgaaccccttcatctacagcctgaagaacaaggaggtgaagacggctatgaggaagctg
ctcggaagatgctgccagcattttgggtatgttggtcggagacgcagggtgaagtcttga

DBGET integrated database retrieval system